KEGG   Mycobacterium tuberculosis H37Rv: Rv0500Help
Entry
Rv0500            CDS       T00015                                 

Gene name
proC
Definition
(RefSeq) pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00330  Arginine and proline metabolism
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01130  Biosynthesis of antibiotics
mtu01230  Biosynthesis of amino acids
Module
mtu_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    Rv0500 (proC)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     Rv0500 (proC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5CR_dimer F420_oxidored NAD_binding_2 Shikimate_DH GFO_IDH_MocA Sacchrp_dh_NADP NAD_binding_7 TrkA_N Rossmann-like ApbA IlvN
Motif
Other DBs
NCBI-GeneID: 887256
NCBI-ProteinID: NP_215014
TubercuList: Rv0500
UniProt: P9WHU7 I6Y7Z2
Position
590083..590970
Genome map
AA seq 295 aa AA seqDB search
MLFGMARIAIIGGGSIGEALLSGLLRAGRQVKDLVVAERMPDRANYLAQTYSVLVTSAAD
AVENATFVVVAVKPADVEPVIADLANATAAAENDSAEQVFVTVVAGITIAYFESKLPAGT
PVVRAMPNAAALVGAGVTALAKGRFVTPQQLEEVSALFDAVGGVLTVPESQLDAVTAVSG
SGPAYFFLLVEALVDAGVGVGLSRQVATDLAAQTMAGSAAMLLERMEQDQGGANGELMGL
RVDLTASRLRAAVTSPGGTTAAALRELERGGFRMAVDAAVQAAKSRSEQLRITPE
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgcttttcggcatggcaaggatcgcgattatcggcggcggcagcatcggtgaggcattg
ctgtcgggtctgctgcgggcgggccggcaggtcaaagacctggtagtggccgagcggatg
cccgatcgcgccaactacctggcgcagacctattcggtgttggtgacgtcggcggccgac
gcggtggagaacgcgacgttcgtcgtcgtcgcggtcaaaccagccgacgtcgagccggtg
atcgcggatctggcgaacgcgactgcggcggccgaaaacgacagtgctgagcaggtgttc
gtcaccgtggtagcgggcatcacgatcgcgtatttcgaatccaagctaccggctgggacg
ccagtggtgcgtgcgatgccgaacgcggcggcattggtgggagcgggggttacagcgctg
gccaaaggccgctttgtcaccccgcaacagcttgaggaggtctcggccttgttcgacgcg
gtcggcggcgtgctgaccgttccggaatcgcagttggacgcggtgaccgcggtgtccggc
tcgggtccggcctatttctttctgctggtcgaggccctggtggatgccggagtcggggtg
ggcttgagccgtcaggtggccaccgatctcgccgcgcagacaatggctggctcagcggcg
atgctgctggagcggatggagcaagaccagggtggcgccaatggcgagctgatggggctg
cgcgtggaccttaccgcatcacggctgcgcgccgcggttacctcgccgggcggtacgacc
gccgctgcgctgcgggaactcgaacgcggcgggtttcggatggctgtcgacgcggcggtt
caagccgccaaaagccgctctgagcagctcagaattacaccggaatga

DBGET integrated database retrieval system