KEGG   Mycobacterium tuberculosis H37Rv: Rv0503cHelp
Entry
Rv0503c           CDS       T00015                                 

Gene name
cmaA2
Definition
(RefSeq) cyclopropane mycolic acid synthase
  KO
K00574  cyclopropane-fatty-acyl-phospholipid synthase [EC:2.1.1.79]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Rv0503c (cmaA2)
Enzymes [BR:mtu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.79  cyclopropane-fatty-acyl-phospholipid synthase
     Rv0503c (cmaA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CMAS Methyltransf_23 Methyltransf_25 Methyltransf_12 Methyltransf_11 Methyltransf_31 PCMT RrnaAD Methyltransf_9
Motif
Other DBs
NCBI-GeneID: 887264
NCBI-ProteinID: NP_215017
TubercuList: Rv0503c
UniProt: P9WPB5 I6Y7Z6
Structure
PDB: 

Position
complement(593871..594779)
Genome map
AA seq 302 aa AA seqDB search
MTSQGDTTSGTQLKPPVEAVRSHYDKSNEFFKLWLDPSMTYSCAYFERPDMTLEEAQYAK
RKLALDKLNLEPGMTLLDIGCGWGSTMRHAVAEYDVNVIGLTLSENQYAHDKAMFDEVDS
PRRKEVRIQGWEEFDEPVDRIVSLGAFEHFADGAGDAGFERYDTFFKKFYNLTPDDGRML
LHTITIPDKEEAQELGLTSPMSLLRFIKFILTEIFPGGRLPRISQVDYYSSNAGWKVERY
HRIGANYVPTLNAWADALQAHKDEAIALKGQETYDIYMHYLRGCSDLFRDKYTDVCQFTL
VK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcacagggcgacacgacaagcggcacgcagctcaagccgccggtcgaagcagtt
cgatcccactacgacaaatcgaacgagttcttcaagctctggcttgacccatcgatgacg
tacagctgcgcctacttcgaacgtcccgatatgacgctggaagaggcgcagtacgcgaag
cgcaagctggcactggacaagctgaaccttgagcccggcatgacgctgctcgacatcggc
tgcggctggggttccaccatgcgacacgcggtcgccgagtacgacgtcaacgtcatcggc
ttgaccctgagcgaaaaccagtacgcccacgacaaggcgatgttcgatgaggtcgacagc
ccccgccgaaaagaggtgcgaatccagggctgggaggagttcgacgagccggtcgaccgc
atcgtgtcactcggtgcgtttgagcatttcgccgacggtgccggggacgccgggttcgag
cgctacgacaccttcttcaagaagttctacaatttgacgcccgacgacggccggatgctg
ctgcacaccatcactatcccggacaaagaggaagcccaggagctgggcttgacgtctccg
atgagcctgctgcgcttcatcaagttcatcctgaccgagatcttcccgggcgggcggctg
cccaggatctcgcaggtggactattactcctccaacgccggatggaaggtcgagcgctac
caccggatcggggccaactacgtgccgaccctgaacgcctgggcggatgcgctacaggcg
cacaaagatgaggcgatcgccctcaagggccaggagacgtacgacatctacatgcactac
ctacgtggctgctcagacctgttccgcgacaagtacacggacgtctgccagttcactctg
gtcaaataa

DBGET integrated database retrieval system