KEGG   Mycobacterium tuberculosis H37Rv: Rv0509Help
Entry
Rv0509            CDS       T00015                                 

Gene name
hemA
Definition
(RefSeq) glutamyl-tRNA reductase
  KO
K02492  glutamyl-tRNA reductase [EC:1.2.1.70]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00860  Porphyrin and chlorophyll metabolism
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01120  Microbial metabolism in diverse environments
Module
mtu_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Rv0509 (hemA)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.70  glutamyl-tRNA reductase
     Rv0509 (hemA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GlutR_N Shikimate_DH GlutR_dimer Glu_dehyd_C Sacchrp_dh_NADP NAD_binding_2 ThiF F420_oxidored ApbA NAD_binding_7 NAD_binding_8 NAD_binding_10 TfuA
Motif
Other DBs
NCBI-GeneID: 887292
NCBI-ProteinID: NP_215023
TubercuList: Rv0509
UniProt: P9WMP7 I6WYK5
Position
600441..601847
Genome map
AA seq 468 aa AA seqDB search
MSVLLFGVSHRSAPVVVLEQLSIDESDQVKIIDRVLASPLVTEAMVLSTCNRVEVYAVVD
AFHGGLSVIGQVLAEHSGMSMGELTKYAYVRYSEAAVEHLFAVASGLDSAVIGEQQVLGQ
VRRAYAVAESNRTVGRVLHELAQRALSVGKRVHSETAIDAAGASVVSVALGMAERKLGSL
AGTTAVVIGAGAMGALSAVHLTRAGVGHIQVLNRSLSRAQRLARRIRESGVPAEALALDR
LANVLADADVVVSCTGAVRPVVSLADVHHALAAARRDEATRPLVICDLGMPRDVDPAVAR
LPCVWVVDVDSVQHEPSAHAAAADVEAARHIVAAEVASYLVGQRMAEVTPTVTALRQRAA
EVVEAELLRLDNRLPGLQSVQREEVARTVRRVVDKLLHAPTVRIKQLASAPGGDSYAEAL
RELFELDQTAVDAVATAGELPVVPSGFDAESRRGGGDMQSSPKRSPSN
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgtgctgctcttcggggtgtcgcatcgtagcgcgccggtcgtcgtccttgaacaa
ctcagtatcgacgaatccgatcaagtcaagatcatcgaccgagtgctggcttcgccgctg
gtgaccgaggcgatggtgctgtcgacttgcaaccgcgtcgaggtctacgccgtagtggac
gcgttccatggcggcctgtcggtgatcgggcaggtgcttgccgaacactccggtatgtcg
atgggggagctgaccaagtacgcatatgtccgctacagcgaggcagcagttgagcacctg
ttcgcggttgccagcggcctggactcggcggtgatcggcgagcagcaggtgcttggtcag
gtgcgccgcgcctatgccgtcgccgaatccaaccgcacggtcggccgcgtgctgcacgaa
ttggcccagcgggcgctgtcggtgggcaagcgagtgcactccgaaaccgccattgacgct
gccggtgcctccgtggtgtcggtcgccctgggaatggccgagcgcaaattgggctcgttg
gcgggcacgaccgcggtggtgatcggcgccggggcgatgggcgcgctgtcggcggtacat
ctgacccgtgccggcgtcgggcacattcaggtgctcaaccggtcgttgtcccgggcgcag
cggttggcccgaaggatccgcgaatctggcgtgccggccgaggcgctagcgctcgaccgc
ctggctaatgtcctggccgatgccgacgtggtggtcagctgtactggggcggtgcgtccg
gtggtgtcgctggccgatgtgcatcatgcgctggccgccgcccgccgtgacgaggccacc
cgtccgttggtgatatgcgacttgggcatgccgcgtgacgtcgatcctgcggtggccaga
ttaccgtgtgtgtgggtcgtggacgtggatagcgtgcaacatgaaccctcggcacatgcc
gcggctgccgacgttgaggccgcccgccacatcgtcgccgccgaagttgccagctatctg
gtggggcagcggatggccgaggtcaccccaaccgtgacggcgttgcgccagcgagccgcc
gaagtggtcgaagcggaattgctgcgcctggacaaccggctgcccggcctgcagagtgtc
cagcgcgaggaggtggcccgcaccgtacggcgagtcgtggacaagctgttgcacgcgcct
accgtgcggatcaagcagctcgccagtgcgcccggcggtgacagctacgccgaggcgctg
cgcgaactcttcgagcttgaccagaccgccgtcgatgccgtcgccactgcaggtgaatta
ccggtggtgccaagcggattcgacgctgaaagtcgccgcggtggaggcgacatgcaaagc
agcccgaagcgatcgccgagtaactga

DBGET integrated database retrieval system