KEGG   Mycobacterium tuberculosis H37Rv: Rv0510Help
Entry
Rv0510            CDS       T00015                                 

Gene name
hemC
Definition
(RefSeq) porphobilinogen deaminase
  KO
K01749  hydroxymethylbilane synthase [EC:2.5.1.61]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00860  Porphyrin and chlorophyll metabolism
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01120  Microbial metabolism in diverse environments
Module
mtu_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Rv0510 (hemC)
Enzymes [BR:mtu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.61  hydroxymethylbilane synthase
     Rv0510 (hemC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Porphobil_deam Porphobil_deamC FrhB_FdhB_N
Motif
Other DBs
NCBI-GeneID: 887306
NCBI-ProteinID: NP_215024
TubercuList: Rv0510
UniProt: P9WMP3 I6Y3Y6
Position
601857..602786
Genome map
AA seq 309 aa AA seqDB search
MIRIGTRGSLLATTQAATVRDALIAGGHSAELVTISTEGDRSMAPIASLGVGVFTTALRE
AMEAGLVDAAVHSYKDLPTAADPRFTVAAIPPRNDPRDAVVARDGLTLGELPVGSLVGTS
SPRRAAQLRALGLGLEIRPLRGNLDTRLNKVSSGDLDAIVVARAGLARLGRLDDVTETLE
PVQMLPAPAQGALAVECRAGDSRLVAVLAELDDADTRAAVTAERALLADLEAGCSAPVGA
IAEVVESIDEDGRVFEELSLRGCVAALDGSDVIRASGIGSCGRARELGLSVAAELFELGA
RELMWGVRH
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
gtgatccggataggtacccggggcagcttgctggccaccactcaggccgccactgtcaga
gacgccctcatcgctggtggccactccgcggagttggtgaccatcagcaccgagggtgac
cgatccatggcgccgatcgccagtctcggggttggcgtcttcaccacggcgttgcgcgag
gcgatggaggcaggcctcgtcgatgcggcggtgcattcgtacaaggatttgccgactgcc
gccgatccaaggttcacggttgcggcgataccgccgcgcaatgacccccgcgacgcggtg
gtagcccgtgacgggctgacgctgggggaattgccggtcggatcgttggtgggcacatcc
tcgccgcggcgggccgcacagcttagagcattgggtctcggtttggaaatccgcccccta
cgaggcaacctagataccaggttgaacaaggtaagtagcggcgatcttgacgccatcgtg
gtggcccgggctggtctggcgcggctgggccgcctcgatgacgtgaccgagacgttagag
ccggtgcagatgttgcccgcgccggctcagggcgcgctcgcggtcgaatgccgcgccggc
gacagccggttggtggcagtgctggcggagttggatgacgccgacacgcgtgcggcggtc
accgccgagcgagccctgcttgccgacctggaggcaggttgctccgcaccggtgggagcg
atcgcagaagtggtcgagtccatcgatgaggacggccgtgtcttcgaggagctgtcgctg
cgcgggtgcgtggcggcgctggacggatccgacgtgatccgcgcgtccggcatcggcagt
tgcggtcgggcacgggagctggggctctcggtcgccgcggagctgttcgagctgggcgcc
cgggagctgatgtggggagtgcggcattag

DBGET integrated database retrieval system