KEGG   Mycobacterium tuberculosis H37Rv: Rv0512Help
Entry
Rv0512            CDS       T00015                                 

Gene name
hemB
Definition
(RefSeq) delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00860  Porphyrin and chlorophyll metabolism
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01120  Microbial metabolism in diverse environments
Module
mtu_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Rv0512 (hemB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mtu04147]
    Rv0512 (hemB)
Enzymes [BR:mtu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Rv0512 (hemB)
Exosome [BR:mtu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Rv0512 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD OMPdecase
Motif
Other DBs
NCBI-GeneID: 887312
NCBI-ProteinID: NP_215026
TubercuList: Rv0512
UniProt: P9WMP5
Position
604602..605591
Genome map
AA seq 329 aa AA seqDB search
MSMSSYPRQRPRRLRSTVAMRRLVAQTSLEPRHLVLPMFVADGIDEPRPITSMPGVVQHT
RDSLRRAAAAAVAAGVGGLMLFGVPRDQDKDGVGSAGIDPDGILNVALRDLAKDLGEATV
LMADTCLDEFTDHGHCGVLDDRGRVDNDATVARYVELAVAQAESGAHVVGPSGMMDGQVA
AIRDGLDAAGYIDVVILAYAAKFASAFYGPFREAVSSSLSGDRRTYQQEPGNAAEALREI
ELDLDEGADIVMVKPAMGYLDVVAAAADVSPVPVAAYQVSGEYAMIRAAAANNWIDERAA
VLESLTGIRRAGADIVLTYWAVDAAGWLT
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgagcatgagttcctatccgcggcagcgaccgcgccggctccgctccaccgtcgcgatg
cgccgtctggttgcgcaaacctcgttggagccaaggcatttggtgctgccgatgttcgtt
gccgacggcattgacgagccgcggccgattacctccatgccgggcgtggtacagcacacc
cgggattcgctacgtagggccgcggcagccgcggtggccgccggcgtgggtgggctgatg
cttttcggcgtgccgcgcgaccaggacaaggacggtgtcggttcggcgggcatcgacccc
gacgggatcctcaacgtcgcccttcgcgatctggccaaggacctgggtgaggccacggtg
ttgatggccgacacctgtctggacgagttcaccgaccacgggcactgcggtgtgctcgat
gaccggggccgggtcgataacgacgccaccgtggcccgctatgtggaactggctgtggcg
caagcggaatcgggcgcccacgtggtcggacccagtgggatgatggatggccaggtagcc
gcgatccgggacggtttggacgccgccggctacatcgatgtggtgatcttggcctacgcc
gcgaagtttgcttcggcgttctacggcccgttccgcgaggcggtgagctctagcctgtcc
ggggatcggcgcacctaccagcaggagccgggcaacgccgccgaggcgctgcgtgagatc
gagctcgatctcgacgaaggcgccgacattgtgatggtcaaacccgcgatgggctacctc
gatgtggtggcggccgcggcggacgtctcgccggtcccggtggccgcctatcaggtctcg
ggagagtacgcgatgattcgtgcggcggcggccaataattggatcgatgagcgtgccgcg
gtgctagagtcgctgaccggtatccggcgtgccggcgccgacatcgtgctcacctactgg
gcggtagacgcggcgggctggcttacgtga

DBGET integrated database retrieval system