KEGG   Mycobacterium tuberculosis H37Rv: Rv0533cHelp
Entry
Rv0533c           CDS       T00015                                 

Gene name
fabH
Definition
(RefSeq) 3-oxoacyl-ACP synthase III
  KO
K11608  beta-ketoacyl-[acyl-carrier-protein] synthase III [EC:2.3.1.180]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mtu01004]
    Rv0533c (fabH)
Enzymes [BR:mtu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.180  beta-ketoacyl-[acyl-carrier-protein] synthase III
     Rv0533c (fabH)
Lipid biosynthesis proteins [BR:mtu01004]
 Fatty acid synthase
  Component type
   Rv0533c (fabH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACP_syn_III_C ACP_syn_III Thiolase_N FAE1_CUT1_RppA Chal_sti_synt_N
Motif
Other DBs
NCBI-GeneID: 887381
NCBI-ProteinID: NP_215047
TubercuList: Rv0533c
UniProt: P9WNG3 I6Y823
Structure
PDB: 

Position
complement(624473..625480)
Genome map
AA seq 335 aa AA seqDB search
MTEIATTSGARSVGLLSVGAYRPERVVTNDEICQHIDSSDEWIYTRTGIKTRRFAADDES
AASMATEACRRALSNAGLSAADIDGVIVTTNTHFLQTPPAAPMVAASLGAKGILGFDLSA
GCAGFGYALGAAADMIRGGGAATMLVVGTEKLSPTIDMYDRGNCFIFADGAAAVVVGETP
FQGIGPTVAGSDGEQADAIRQDIDWITFAQNPSGPRPFVRLEGPAVFRWAAFKMGDVGRR
AMDAAGVRPDQIDVFVPHQANSRINELLVKNLQLRPDAVVANDIEHTGNTSAASIPLAMA
ELLTTGAAKPGDLALLIGYGAGLSYAAQVVRMPKG
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgacggagatcgccacgaccagcggcgccaggagcgtcgggctgctcagtgtcggggcg
taccggcccgaacgcgtggtcaccaacgacgagatatgccagcacatcgactcgtccgac
gagtggatctacacccgaaccggcatcaagacccgccgattcgccgccgacgacgagtcg
gcggcttccatggcgactgaggcctgtcgacgggcactgtcgaacgccggcctgtcggcg
gccgacatcgatggcgtgatcgtcaccaccaacacccatttcctgcaaaccccgccggcc
gccccaatggtcgcggcgtcgctgggcgccaagggcatactcgggttcgatctttcggcg
gggtgcgccggattcggatatgcgcttggcgcagcggccgacatgatccggggcggaggt
gcggccacgatgctggtggtcggcacggaaaaactgtcccccacgatagacatgtacgac
cgcggcaactgcttcatcttcgccgacggcgcggccgcagtggtggtgggcgagacaccg
tttcaaggcattggaccaaccgtggcgggtagcgacggcgaacaggccgatgccatacgg
caggacatcgactggatcactttcgcccagaatcccagcggcccacgcccgtttgtgcgg
ctcgaaggtcccgcggtcttccgttgggcagcgttcaaaatgggcgacgtcggtcggcgc
gcgatggacgccgccggggtgcgacccgaccagatagacgtgttcgtccctcatcaggcc
aatagccgcatcaacgagctgctggtcaagaacctgcagttgcggcccgacgcggtggtc
gccaacgatatcgagcacaccggaaacacctcggcggcctccattccgctcgcgatggcc
gaattactgacgaccggcgcggccaagcccggcgatctggccctgttgatcggctacggc
gccggtctgagctatgccgcccaggtggtgcgaatgccgaagggttga

DBGET integrated database retrieval system