KEGG   Mycobacterium tuberculosis H37Rv: Rv0542cHelp
Entry
Rv0542c           CDS       T00015                                 

Gene name
menE
Definition
(RefSeq) 2-succinylbenzoic acid--CoA ligase
  KO
K01911  O-succinylbenzoic acid---CoA ligase [EC:6.2.1.26]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00130  Ubiquinone and other terpenoid-quinone biosynthesis
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    Rv0542c (menE)
Enzymes [BR:mtu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.26  o-succinylbenzoate---CoA ligase
     Rv0542c (menE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 887507
NCBI-ProteinID: NP_215056
TubercuList: Rv0542c
UniProt: P9WQ39
Position
complement(634416..635504)
Genome map
AA seq 362 aa AA seqDB search
MLGGSDPALVAVPTQHESLLGALRVGEQIDDDVALVVTTSGTTGPPKGAMLTAAALTASA
SAAHDRLGGPGSWLLAVPPYHIAGLAVLVRSVIAGSVPVELNVSAGFDVTELPNAIKRLG
SGRRYTSLVAAQLAKALTDPAATAALAELDAVLIGGGPAPRPILDAAAAAGITVVRTYGM
SETSGGCVYDGVPLDGVRLRVLAGGRIAIGGATLAKGYRNPVSPDPFAEPGWFHTDDLGA
LESGDSGVLTVLGRADEAISTGGFTVLPQPVEAALGTHPAVRDCAVFGLADDRLGQRVVA
AIVVGDGCPPPTLEALRAHVARTLDVTAAPRELHVVNVLPRRGIGKVDRAALVRRFAGEA
DQ
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
gtgctgggtggcagcgacccggcattggtcgcggtgcccacccagcatgagtccttgctg
ggcgctttgcgagtgggcgagcagattgacgacgacgtcgccctggtagtgacgacgtca
ggaaccacgggaccgcccaagggcgccatgttgaccgcggcggccttgaccgccagcgcc
tcggccgcccacgaccggctcggcggaccgggcagctggctgttggctgtgccgccgtat
cacatcgccgggctggcggtgctggtgcgcagcgtgatcgccggatcagttcctgtcgaa
ctgaacgtctccgcgggattcgatgtcaccgaattacccaacgcgataaagagattgggt
tctggccggcgatacacgtcgctggtcgccgcacagttggccaaggcacttaccgacccg
gcggccacggccgcgctggccgaattggacgcggtgctgatcggcggcgggccggccccc
cggcccatcctggacgccgcggccgccgccggcatcacggtggtgcgcacctacggcatg
agcgagacctcgggcggctgtgtctacgacggcgttccgctcgacggggtccggctgagg
gtgctggccggcggccgcatagctatcggcggtgcgaccctggccaagggctatcgcaac
ccggtctcgcccgatccgttcgccgagccaggctggtttcacaccgacgaccttggcgcc
cttgaatcgggtgattcgggtgtgctgaccgtgctgggccgagccgacgaagcgatcagc
acgggcggattcaccgtgctgccgcagccagtggaggccgcactgggcacccaccctgcg
gtgcgtgactgcgcggtttttggacttgccgacgaccgactcggtcagcgagtggtcgcc
gcgattgtggtcggcgacggatgcccaccaccaacgctagaagcgctgcgggcgcatgtc
gcgcgcaccctggacgtcaccgccgcgccccgagagctacatgtcgtgaacgtgctaccg
cgacgcggcatcggcaaggtggaccgggcagcgttggtgcgccggttcgccggtgaagcc
gatcaatag

DBGET integrated database retrieval system