KEGG   Mycobacterium tuberculosis H37Rv: Rv0548cHelp
Entry
Rv0548c           CDS       T00015                                 

Gene name
menB
Definition
(RefSeq) 1,4-dihydroxy-2-naphthoyl-CoA synthase
  KO
K01661  naphthoate synthase [EC:4.1.3.36]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00130  Ubiquinone and other terpenoid-quinone biosynthesis
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    Rv0548c (menB)
Enzymes [BR:mtu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.36  1,4-dihydroxy-2-naphthoyl-CoA synthase
     Rv0548c (menB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 KdpC
Motif
Other DBs
NCBI-GeneID: 887529
NCBI-ProteinID: NP_215062
TubercuList: Rv0548c
UniProt: P9WNP5
Structure
PDB: 

Position
complement(639012..639956)
Genome map
AA seq 314 aa AA seqDB search
MVAPAGEQGRSSTALSDNPFDAKAWRLVDGFDDLTDITYHRHVDDATVRVAFNRPEVRNA
FRPHTVDELYRVLDHARMSPDVGVVLLTGNGPSPKDGGWAFCSGGDQRIRGRSGYQYASG
DTADTVDVARAGRLHILEVQRLIRFMPKVVICLVNGWAAGGGHSLHVVCDLTLASREYAR
FKQTDADVGSFDGGYGSAYLARQVGQKFAREIFFLGRTYTAEQMHQMGAVNAVAEHAELE
TVGLQWAAEINAKSPQAQRMLKFAFNLLDDGLVGQQLFAGEATRLAYMTDEAVEGRDAFL
QKRPPDWSPFPRYF
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
gtggtggctccagccggcgaacaaggacggagttcaacagccttgagtgacaaccctttt
gatgccaaggcgtggcggctcgtggacgggttcgacgatctgaccgacatcacctaccac
cgccacgtcgacgatgccacggtgcgggtggcgttcaaccgccctgaagtgcgcaacgca
tttcgcccgcacaccgtcgacgagctgtaccgggtgctcgaccatgcacgaatgtcgccc
gacgtcggagtggtgctgctgaccggcaacgggccgtccccgaaggacggcggctgggcg
ttctgctccggcggcgaccaacgaattcgtgggcgcagcggttaccagtacgccagcgga
gacaccgcggacacggttgatgtcgcccgcgccggccggttgcacatcctggaggtgcag
cggctgatccggttcatgcccaaggtggtcatttgtctggtcaatggctgggcggccggc
gggggacacagcctgcacgtggtctgcgatctcaccctggccagccgcgagtacgcccgc
ttcaagcagaccgacgccgacgtcggcagcttcgatggcggttacggcagcgcatatctg
gcccgtcaggtcggccagaagtttgcccgcgagatcttcttcctaggccgcacctacacc
gccgagcagatgcaccagatgggcgcggtcaacgcggtggccgaacacgccgagctggag
acagtggggctgcagtgggcggccgagatcaacgcgaaatcgcctcaggcgcaacggatg
ctgaagttcgcgttcaacctgctcgacgacgggctggtgggtcagcaactgtttgccggt
gaggccacccgcctggcctacatgaccgacgaggccgtcgaaggccgcgacgccttccta
cagaagcgtccccccgactggagcccgtttccgcgctatttctaa

DBGET integrated database retrieval system