KEGG   Mycobacterium tuberculosis H37Rv: Rv0562Help
Entry
Rv0562            CDS       T00015                                 

Gene name
grcC1
Definition
(RefSeq) polyprenyl-diphosphate synthase GrcC
  KO
K00805  heptaprenyl diphosphate synthase [EC:2.5.1.30]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00900  Terpenoid backbone biosynthesis
mtu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Rv0562 (grcC1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:mtu01006]
    Rv0562 (grcC1)
Enzymes [BR:mtu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.30  heptaprenyl diphosphate synthase
     Rv0562 (grcC1)
Prenyltransferases [BR:mtu01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   Rv0562 (grcC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-GeneID: 887647
NCBI-ProteinID: NP_215076
TubercuList: Rv0562
UniProt: O06428 L0T414
Position
652771..653778
Genome map
AA seq 335 aa AA seqDB search
MRTPATVVAGVDLGDAVFAAAVRAGVARVEQLMDTELRQADEVMSDSLLHLFNAGGKRFR
PLFTVLSAQIGPQPDAAAVTVAGAVIEMIHLATLYHDDVMDEAQVRRGAPSANAQWGNNV
AILAGDYLLATASRLVARLGPEAVRIIADTFAQLVTGQMRETRGTSENVDSIEQYLKVVQ
EKTGSLIGAAGRLGGMFSGATDEQVERLSRLGGVVGTAFQIADDIIDIDSESDESGKLPG
TDVREGVHTLPMLYALRESGPDCARLRALLNGPVDDDAEVREALTLLRASPGMARAKDVL
AQYAAQARHELALLPDVPGRRALAALVDYTVSRHG
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
gtgaggactccggcgacggtggtggcaggcgttgacctgggcgacgctgtctttgccgcg
gccgtgcgtgctggtgtcgcgcgagtcgagcaactcatggacaccgagctgcgccaggcc
gacgaggtgatgagcgattcgctgctgcacttgttcaatgccggcggcaagcggttccgt
ccactgttcaccgtgctgtcggcgcagatcgggccgcagccggatgccgcagcggtgaca
gtcgccggggcggtgatcgagatgatccacctggcgaccctctaccacgatgacgtgatg
gacgaggcccaggtccgccgcggcgcgcccagcgccaacgcgcaatggggtaacaacgtc
gcgatcctggctggcgactacctactggccaccgcatcgcggctggtggcgaggttggga
ccggaggcggtgcggatcatcgccgacaccttcgcccagttggtgaccgggcagatgcgt
gagacgcgcggcacgtcggagaacgtggactccatcgagcagtacctgaaggtggtccag
gagaagaccggcagtctaatcggggcggccggccggctgggtgggatgttctccggtgcc
accgacgaacaggtcgaacggctgagccgcctcggcggcgtggtgggcaccgcgtttcag
atcgccgacgacattatcgacatcgacagcgagtctgacgagtcgggcaagctgcccggt
accgatgtgcgcgaaggagtacacaccctgccgatgctctacgcgttacgggaatcaggg
cccgattgcgctcggttgcgcgcactgctgaacggaccggtcgacgacgacgccgaggtg
cgcgaggcgctgacattgttgcgggcgtcgccgggcatggcccgggccaaagacgtcctg
gcgcagtacgcggctcaggcacgtcacgagctggccttactgcccgacgtcccgggacgg
cgtgccctggcggcgctggtcgactacaccgtgagccggcacggctag

DBGET integrated database retrieval system