KEGG   Mycobacterium tuberculosis H37Rv: Rv0620Help
Entry
Rv0620            CDS       T00015                                 

Gene name
galK
Definition
(RefSeq) galactokinase
  KO
K00849  galactokinase [EC:2.7.1.6]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00052  Galactose metabolism
mtu00520  Amino sugar and nucleotide sugar metabolism
mtu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    Rv0620 (galK)
   00520 Amino sugar and nucleotide sugar metabolism
    Rv0620 (galK)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mtu04147]
    Rv0620 (galK)
Enzymes [BR:mtu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.6  galactokinase
     Rv0620 (galK)
Exosome [BR:mtu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Rv0620 (galK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GalKase_gal_bdg GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-GeneID: 887936
NCBI-ProteinID: NP_215134
TubercuList: Rv0620
UniProt: P9WN63 I6XVS8
Position
712716..713807
Genome map
AA seq 363 aa AA seqDB search
MTVSYGAPGRVNLIGEHTDYNLGFALPIALPRRTVVTFTPEHTGAITARSDRADGSARIP
LDTTPGQVTGWAAYAAGAIWALRGAGHPVPGGAMSITSDVEIGSGLSSSAALIGAVLGAV
GAATGTRIDRLERARLAQRAENDYVGAPTGLLDHLAALFGAPKTALLIDFRDITVRPVAF
DPDACDVVLLLMDSRARHCHAGGEYALRRASCERAAADLGVSSLRAVQDRGLAALGAIAD
PIDARRARHVLTENQRVLDFAAALADSDFTAAGQLLTASHESMREDFAITTERIDLIAES
AVRAGALGARMTGGGFGGAVIALVPADRARDVADTVRRAAVTAGYDEPAVSRTYAAPGAA
ECR
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgacggtcagctacggcgcacccgggcgggtcaacctgatcggcgaacacaccgattac
aacctgggtttcgcgctgccgattgcgttgccgcggcgcaccgttgtcacgttcaccccc
gagcacaccggcgcgatcaccgcgcgcagcgaccgcgccgacggctcggcgcggatcccg
ctcgacaccacgccggggcaggtgaccggctgggcagcctatgcggccggggcgatctgg
gcgctgcggggcgccggccacccggtgcccggcggggcgatgtcgatcaccagcgacgtc
gagatcgggtcggggctttcgtcgtcggcggcgctgatcggcgcggtgctgggcgcggtc
ggcgccgccaccggcacccgcatcgaccgtctcgagcgggcccggctcgcacagcgagcc
gagaacgactacgtcggtgccccaacgggtttgctcgaccacctggccgcgctgttcgga
gcgccgaagaccgcgctgctgatcgactttcgcgacatcaccgtgcgcccggtggccttc
gacccggacgcctgcgatgtggtgctgctgttgatggattctcgagcccgacactgtcac
gccggcggggagtatgcgctgcgccgggcgtcgtgtgaacgggcggccgccgatctgggg
gtgtcctcgttgcgcgctgtgcaggatcgcgggctggcggcgctgggcgcgatcgccgat
ccgatcgacgcgcgccgcgcccggcacgtgctgaccgagaatcagcgggtgctggatttc
gcggccgcactggctgattcggatttcaccgccgccgggcagctgctgaccgcgtcgcat
gagtccatgcgcgaggacttcgccatcaccaccgagcggatcgatctgatcgccgagagc
gccgtacgggccggtgcgctgggcgcccggatgaccgggggcggcttcgggggcgccgtg
atcgcactggtgcctgccgatagggcgcgcgacgtggccgacacggtgcgacgggcggcg
gtcaccgccggctacgacgagccggcggtgagccggacctatgccgcgcccggcgcggcc
gagtgccgttga

DBGET integrated database retrieval system