KEGG   Mycobacterium tuberculosis H37Rv: Rv0733Help
Entry
Rv0733            CDS       T00015                                 

Gene name
adk
Definition
(RefSeq) adenylate kinase
  KO
K00939  adenylate kinase [EC:2.7.4.3]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00230  Purine metabolism
mtu00730  Thiamine metabolism
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01130  Biosynthesis of antibiotics
Module
mtu_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Rv0733 (adk)
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    Rv0733 (adk)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mtu04147]
    Rv0733 (adk)
Enzymes [BR:mtu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.3  adenylate kinase
     Rv0733 (adk)
Exosome [BR:mtu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Rv0733 (adk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADK AAA_17 AAA_33 AAA_18 Cytidylate_kin AAA_28 AAA IPT RuvB_N AAA_5
Motif
Other DBs
NCBI-GeneID: 888567
NCBI-ProteinID: NP_215247
TubercuList: Rv0733
UniProt: P9WKF5 I6WZ75
Structure
PDB: 

Position
826122..826667
Genome map
AA seq 181 aa AA seqDB search
MRVLLLGPPGAGKGTQAVKLAEKLGIPQISTGELFRRNIEEGTKLGVEAKRYLDAGDLVP
SDLTNELVDDRLNNPDAANGFILDGYPRSVEQAKALHEMLERRGTDIDAVLEFRVSEEVL
LERLKGRGRADDTDDVILNRMKVYRDETAPLLEYYRDQLKTVDAVGTMDEVFARALRALG
K
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
gtgagagttttgttgctgggaccgcccggggcgggcaaggggacgcaggcggtgaagctg
gccgagaagctcgggatcccgcagatctccaccggcgaactcttccggcgcaacatcgaa
gagggcaccaagctcggcgtggaagccaaacgctacttggatgccggtgacttggtgccg
tccgacttgaccaatgaactcgtcgacgaccggctgaacaatccggacgcggccaacgga
ttcatcttggatggctatccacgctcggtcgagcaggccaaggcgcttcacgagatgctc
gaacgccgggggaccgacatcgacgcggtgctggagtttcgtgtgtccgaggaggtgttg
ttggagcgactcaaggggcgtggccgcgccgacgacaccgacgacgtcatcctcaaccgg
atgaaggtctaccgcgacgagaccgcgccgctgctggagtactaccgcgaccaattgaag
accgtcgacgccgtcggcaccatggacgaggtgttcgcccgtgcgttgcgggctctggga
aagtag

DBGET integrated database retrieval system