KEGG   Mycobacterium tuberculosis H37Rv: Rv0757Help
Entry
Rv0757            CDS       T00015                                 

Gene name
phoP
Definition
(RefSeq) two component system response transcriptional positive regulator PhoP
  KO
K02483  two-component system, OmpR family, response regulator
Organism
mtu  Mycobacterium tuberculosis H37Rv
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:mtu02022]
    Rv0757 (phoP)
Two-component system [BR:mtu02022]
 OmpR family
  Unclassified
   Rv0757 (phoP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C FleQ B12-binding_2 B12-binding
Motif
Other DBs
NCBI-GeneID: 888772
NCBI-ProteinID: NP_215271
TubercuList: Rv0757
UniProt: P71814
Structure
PDB: 

Position
851608..852351
Genome map
AA seq 247 aa AA seqDB search
MRKGVDLVTAGTPGENTTPEARVLVVDDEANIVELLSVSLKFQGFEVYTATNGAQALDRA
RETRPDAVILDVMMPGMDGFGVLRRLRADGIDAPALFLTARDSLQDKIAGLTLGGDDYVT
KPFSLEEVVARLRVILRRAGKGNKEPRNVRLTFADIELDEETHEVWKAGQPVSLSPTEFT
LLRYFVINAGTVLSKPKILDHVWRYDFGGDVNVVESYVSYLRRKIDTGEKRLLHTLRGVG
YVLREPR
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgcggaaaggggttgatctcgtgacggcgggaaccccaggcgaaaacaccacaccggag
gctcgtgtcctcgtggtcgatgatgaggccaacatcgttgaactgctgtcggtgagcctc
aagttccagggctttgaagtctacaccgcgaccaacggggcacaggcgctggatcgggcc
cgggaaacccggccggacgcggtgatcctcgatgtgatgatgcccgggatggacggcttt
ggggtgctgcgccggctgcgcgccgacggcatcgatgccccggcgttgttcctgacggcc
cgtgactcgctacaggacaagatcgcgggtctgaccctgggtggtgacgactatgtgaca
aagcccttcagtttggaggaggtcgtggccaggctgcgggtcatcctgcgacgcgcgggc
aagggcaacaaggaaccacgtaatgttcgactgacgttcgccgatatcgagctcgacgag
gagacccacgaagtgtggaaggcgggccaaccggtgtcgctgtcgcccaccgaattcacc
ctgctgcgctatttcgtgatcaacgcgggcaccgtgctgagcaagcctaagattctcgac
cacgtttggcgctacgacttcggtggtgatgtcaacgtcgtcgagtcctacgtgtcgtat
ctgcgccgcaagatcgacactggggagaagcggctgctgcacacgctgcgcggggtgggc
tacgtactgcgggagcctcgatga

DBGET integrated database retrieval system