KEGG   Mycobacterium tuberculosis H37Rv: Rv0780Help
Entry
Rv0780            CDS       T00015                                 

Gene name
purC
Definition
(RefSeq) phosphoribosylaminoimidazole-succinocarboxamide synthase
  KO
K01923  phosphoribosylaminoimidazole-succinocarboxamide synthase [EC:6.3.2.6]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00230  Purine metabolism
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01130  Biosynthesis of antibiotics
Module
mtu_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Rv0780 (purC)
Enzymes [BR:mtu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.6  phosphoribosylaminoimidazolesuccinocarboxamide synthase
     Rv0780 (purC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SAICAR_synt
Motif
Other DBs
NCBI-GeneID: 888928
NCBI-ProteinID: NP_215294
TubercuList: Rv0780
UniProt: P9WHN1 I6WZF1
Position
873343..874236
Genome map
AA seq 297 aa AA seqDB search
MRPALSDYQHVASGKVREIYRVDDEHLLLVASDRISAYDYVLDSTIPDKGRVLTAMSAFF
FGLVDAPNHLAGPPDDPRIPDEVLGRALVVRRLEMLPVECVARGYLTGSGLLDYQATGKV
CGIALPPGLVEASRFATPLFTPATKAALGDHDENISFDRVVEMVGALRANQLRDRTLQTY
VQAADHALTRGIIIADTKFEFGIDRHGNLLLADEIFTPDSSRYWPADDYRAGVVQTSFDK
QFVRSWLTGSESGWDRGSDRPPPPLPEHIVEATRARYINAYERISELKFDDWIGPGA
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgcgccccgcattgtccgactaccagcatgtggccagcggtaaggtccgcgagatctac
cgtgtcgatgacgagcacctgctgctggttgccagcgaccggatctcggcgtacgactac
gtcctggacagcaccatcccggacaagggccgcgtcctgaccgccatgagcgcattcttc
ttcgggctcgtcgatgcccctaaccatctggccgggccgccggacgacccgcgtatcccc
gacgaggtgctgggccgcgcgctggtggtgcgtcggctggagatgctgccggtggaatgt
gtggcccgtggctacctgaccggttcggggttactggattaccaggcaaccgggaaggta
tgcggtatcgcgctgccgccgggcctggtcgaggccagtcggttcgccacaccgctgttc
accccggcgactaaagccgcgttgggggaccacgacgagaacatctcgtttgaccgggtg
gtggagatggtaggcgcgttgcgtgccaaccagctgcgtgatcgtactctgcagacgtat
gtgcaggccgccgatcacgctctcacccgcggaatcattatcgccgacaccaagtttgaa
tttggcatcgaccgccacggcaacctgctgctggccgacgaaatcttcacaccggactcg
tcgcggtactggcctgccgacgactaccgggccggcgtggtccagaccagcttcgacaaa
cagtttgtccgcagctggctcaccggctccgagtccggctgggatagaggcagcgatcgg
ccgccgcctccgctccccgagcatatcgtcgaggccacgcgtgcccgttatattaatgca
tacgaacggatttccgaactaaaattcgacgactggatcggccctggcgcatga

DBGET integrated database retrieval system