KEGG   Mycobacterium tuberculosis H37Rv: Rv0803Help
Entry
Rv0803            CDS       T00015                                 

Gene name
purL
Definition
(RefSeq) phosphoribosylformylglycinamidine synthase 2
  KO
K01952  phosphoribosylformylglycinamidine synthase [EC:6.3.5.3]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00230  Purine metabolism
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01130  Biosynthesis of antibiotics
Module
mtu_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Rv0803 (purL)
Enzymes [BR:mtu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.3  phosphoribosylformylglycinamidine synthase
     Rv0803 (purL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C AIRS FGAR-AT_linker DUF5605
Motif
Other DBs
NCBI-GeneID: 885358
NCBI-ProteinID: NP_215318
TubercuList: Rv0803
UniProt: P9WHL7
Position
895820..898084
Genome map
AA seq 754 aa AA seqDB search
MLDTVEHAATTPDQPQPYGELGLKDDEYRRIRQILGRRPTDTELAMYSVMWSEHCSYKSS
KVHLRYFGETTSDEMRAAMLAGIGENAGVVDIGDGWAVTFKVESHNHPSYVEPYQGAATG
VGGIVRDIMAMGARPVAVMDQLRFGAADAPDTRRVLDGVVRGIGGYGNSLGLPNIGGETV
FDPCYAGNPLVNALCVGVLRQEDLHLAFASGAGNKIILFGARTGLDGIGGVSVLASDTFD
AEGSRKKLPSVQVGDPFMEKVLIECCLELYAGGLVIGIQDLGGAGLSCATSELASAGDGG
MTIQLDSVPLRAKEMTPAEVLCSESQERMCAVVSPKNVDAFLAVCRKWEVLATVIGEVTD
GDRLQITWHGETVVDVPPRTVAHEGPVYQRPVARPDTQDALNADRSAKLSRPVTGDELRA
TLLALLGSPHLCSRAFITEQYDRYVRGNTVLAEHADGGMLRIDESTGRGIAVSTDASGRY
TLLDPYAGAQLALAEAYRNVAVTGATPVAVTNCLNFGSPEDPGVMWQFTQAVRGLADGCA
DLGIPVTGGNVSFYNQTGSAAILPTPVVGVLGVIDDVRRRIPTGLGAEPGETLMLLGDTR
DEFDGSVWAQVTADHLGGLPPVVDLAREKLLAAVLSSASRDGLVSAAHDLSEGGLAQAIV
ESALAGETGCRIVLPEGADPFVLLFSESAGRVLVAVPRTEESRFRGMCEARGLPAVRIGV
VDQGSDAVEVQGLFAVSLAELRATSEAVLPRYFG
NT seq 2265 nt NT seq  +upstreamnt  +downstreamnt
gtgctggacaccgtcgaacacgccgcgaccacacccgaccaaccacaaccgtatggtgag
ctgggcctcaaagacgacgagtaccggcggattcgccagatcctgggccgccggcccacc
gacaccgagctggccatgtactcggtgatgtggagcgaacactgttcgtacaagtcctcc
aaggtgcacctgcgctacttcggtgagaccacctccgacgagatgcgcgcggccatgctg
gccggcatcggcgagaacgccggcgtcgtcgacatcggcgacggctgggcggtcaccttc
aaggtggagtcacacaaccacccgtcctacgtcgagccctaccagggcgcggccaccggg
gtgggcggcatcgtccgcgacatcatggccatgggcgcccgaccggtcgccgtgatggac
cagcttcggttcggcgccgccgacgcccccgatacccgccgcgtgctcgacggcgtggtc
cgcggcatcggcggatacggcaactccctgggcctgcccaacattggcggagagaccgtc
ttcgacccgtgctacgccggcaaccccttagtgaacgcgttgtgtgtcggcgtattacgg
caggaggacctgcatttggcgttcgcctccggcgccggcaacaagatcatcctgtttggc
gcgcgcaccgggctcgacggtatcggcggggtgtcggtgctggcgtcggacaccttcgat
gccgagggatcccgcaagaagctgccctcggtgcaggtcggcgacccgttcatggagaag
gtgctcatcgaatgctgtctcgagctctacgcgggcggcctggtgatcggcatccaagac
ctgggcggagccggattatcttgtgccacatcggagttagcatccgccggtgatggcgga
atgacgatccagctggacagcgtcccgctgcgggccaaggagatgacgcccgccgaggtg
ctctgcagcgaatcgcaggagcggatgtgcgcggtggtctccccgaagaacgtcgacgca
ttcctggcggtgtgccgcaagtgggaggtgctggcgacggtgatcggcgaggtcaccgac
ggcgaccggctgcagatcacctggcacggcgagacggtggtcgacgtgccgccgcgcacc
gtagctcacgaaggtccggtatatcagcgcccggtcgcccgccccgatacgcaggacgcg
ctgaacgccgaccgctcggccaagctgtcacggccggtcaccggcgacgagctgcgcgcg
actttgcttgcgttacttggcagcccgcacctgtgcagccgcgcgttcatcaccgagcag
tacgaccgctatgtgcgcggcaacacggtgctcgccgagcacgccgacggcggcatgctg
cgcatcgacgagtcgaccggccggggcatcgcggtatcgaccgacgcgtcgggacgctac
acgctgctggatccctacgctggcgcgcaactcgcgttggccgaggcgtaccgcaacgtc
gccgtcaccggcgccaccccggtcgcggtgaccaactgcctgaacttcggttcccccgag
gaccccggcgtgatgtggcagttcacgcaggcggtccgcggtctggccgatggctgtgcg
gacctcgggattccggtgaccggtggcaacgtgagtttctacaaccaaaccggttcggcg
gcaatcctgcccacgccggtggtcggggtgctcggcgtcatcgacgatgtgcgtcggcgc
atccctaccggcctgggcgccgagcccggggaaacgttgatgctgttgggcgacacccgc
gacgagttcgacggttccgtgtgggcgcaggtgaccgcagaccacctgggtggattgccg
ccggtagtcgatctggcgcgggagaagctgctggccgcggtgctgagctcggcgtcgcgg
gacgggctagtgtccgcggcgcacgatctgtccgagggtgggctggcccaagccatcgtg
gaatcggcgttagcgggtgaaaccggttgccgcatagtgcttcccgaaggggctgacccg
tttgtgctgctgttctccgagtcggcgggtcgggtgctggtcgcggtgccacgcaccgag
gagagccggtttcgcgggatgtgtgaggcgcggggacttcccgcggtccgcatcggcgtc
gtcgatcaaggttcggacgcggttgaggtgcagggcttgttcgcggtgtcgttggccgaa
ctgcgtgcgacatccgaggcggtgttgccgcgatacttcggatga

DBGET integrated database retrieval system