KEGG   Mycobacterium tuberculosis H37Rv: Rv0808Help
Entry
Rv0808            CDS       T00015                                 

Gene name
purF
Definition
(RefSeq) amidophosphoribosyltransferase
  KO
K00764  amidophosphoribosyltransferase [EC:2.4.2.14]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00230  Purine metabolism
mtu00250  Alanine, aspartate and glutamate metabolism
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01130  Biosynthesis of antibiotics
Module
mtu_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Rv0808 (purF)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Rv0808 (purF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:mtu01002]
    Rv0808 (purF)
Enzymes [BR:mtu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.14  amidophosphoribosyltransferase
     Rv0808 (purF)
Peptidases [BR:mtu01002]
 Cysteine Peptidases
  Family C44
   Rv0808 (purF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_6 GATase_7 Pribosyltran GATase_2 GATase_4
Motif
Other DBs
NCBI-GeneID: 885085
NCBI-ProteinID: NP_215323
TubercuList: Rv0808
UniProt: P9WHQ7
Position
902111..903694
Genome map
AA seq 527 aa AA seqDB search
MAVDSDYVTDRAAGSRQTVTGQQPEQDLNSPREECGVFGVWAPGEDVAKLTYYGLYALQH
RGQEAAGIAVADGSQVLVFKDLGLVSQVFDEQTLAAMQGHVAIGHCRYSTTGDTTWENAQ
PVFRNTAAGTGVALGHNGNLVNAAALAARARDAGLIATRCPAPATTDSDILGALLAHGAA
DSTLEQAALDLLPTVRGAFCLTFMDENTLYACRDPYGVRPLSLGRLDRGWVVASETAALD
IVGASFVRDIEPGELLAIDADGVRSTRFANPTPKGCVFEYVYLARPDSTIAGRSVHAARV
EIGRRLARECPVEADLVIGVPESGTPAAVGYAQESGVPYGQGLMKNAYVGRTFIQPSQTI
RQLGIRLKLNPLKEVIRGKRLIVVDDSIVRGNTQRALVRMLREAGAVELHVRIASPPVKW
PCFYGIDFPSPAELIANAVENEDEMLEAVRHAIGADTLGYISLRGMVAASEQPTSRLCTA
CFDGKYPIELPRETALGKNVIEHMLANAARGAALGELAADDEVPVGR
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
gtggccgtagactcggattacgtcaccgaccgcgccgcagggagccgccaaaccgtgacc
ggccagcaacccgagcaagacctgaactcgccccgggaagagtgcggtgtcttcggggtc
tgggccccgggtgaagacgtcgccaaactcacctactacggcctgtacgcgttgcagcat
cgcggccaggaagccgccgggatcgccgtcgccgacggctcccaggtgctggtcttcaaa
gacctcggcctggtcagccaggtgttcgacgagcagacgttggcggccatgcagggccat
gtcgccatcgggcactgtcgttactccaccaccggggacacgacgtgggagaacgcccag
cccgtgttccgcaacaccgccgctggcaccggtgttgcgttgggccacaacggaaatctg
gtcaatgccgctgcccttgccgcccgcgcccgcgacgcggggttgatcgccacccgctgc
ccagccccggcgacgacggactccgacattctgggggcgctgctggcccacggtgctgcc
gattccaccctcgaacaggcggcgctggacctgctgcccacagtgcggggagcgttctgt
ctgacgttcatggacgaaaacacgctttatgcgtgccgcgacccgtacggggtgcgcccg
ctatcgctcgggcgtttggaccgtggctgggtggtggcctccgaaacggccgcactcgac
atcgtcggcgcctcgttcgtccgtgatatcgaaccgggcgaattgctggctatcgacgcc
gacggggtgcggtccacccgctttgccaaccccacgcccaagggctgcgtattcgaatac
gtctacctggcgcggccggacagtacgatcgccggccggtcggtacacgccgcgcgggtg
gagatcggtcgccgactggctcgggaatgcccggtcgaggccgacttggtgattggtgtg
ccggaatccggcacacccgccgcggtcggctacgcgcaggagtccggcgttccatatggg
cagggtctgatgaagaacgcctatgtcgggcgcaccttcatccagccgtcacagaccatc
cgtcagctcggcatccggctgaagctcaacccgctcaaagaggtgatccgcggcaagcgg
ctcatcgtcgtcgacgactcgatcgtgcggggcaacacccagcgtgcgctggtacgcatg
ctgcgcgaggccggtgcggtcgaattgcatgtgcgcatcgcctcgccaccggtgaagtgg
ccgtgcttctacggtatcgacttcccctcgccggccgagttgatcgccaacgccgtggaa
aacgaggacgagatgctggaggcggtacggcatgccatcggggccgacacgctgggatac
atctcgctgcggggcatggtcgcggcgtccgagcagcccacgtcgcggctgtgcaccgct
tgcttcgacggcaagtatccaatagagctgccccgcgagaccgcgctaggcaaaaatgtc
atcgagcacatgctcgccaatgcggcccgcggagccgcgctgggcgaactcgccgccgac
gacgaagtccccgttgggcgctga

DBGET integrated database retrieval system