KEGG   Mycobacterium tuberculosis H37Rv: Rv0809Help
Entry
Rv0809            CDS       T00015                                 

Gene name
purM
Definition
(RefSeq) phosphoribosylformylglycinamidine cyclo-ligase PurM
  KO
K01933  phosphoribosylformylglycinamidine cyclo-ligase [EC:6.3.3.1]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00230  Purine metabolism
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01130  Biosynthesis of antibiotics
Module
mtu_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Rv0809 (purM)
Enzymes [BR:mtu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.3  Cyclo-ligases
    6.3.3.1  phosphoribosylformylglycinamidine cyclo-ligase
     Rv0809 (purM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-GeneID: 885134
NCBI-ProteinID: NP_215324
TubercuList: Rv0809
UniProt: I6Y4V6 A0A089QIW1
Position
903725..904819
Genome map
AA seq 364 aa AA seqDB search
MTDLAKGPGKDPGSRGITYASAGVDIEAGDRAIDLFKPLASKATRPEVRGGLGGFAGLFT
LRGDYREPVLAASSDGVGTKLAIAQAMDKHDTVGLDLVAMVVDDLVVCGAEPLFLLDYIA
VGRIVPERLSAIVAGIADGCMRAGCALLGGETAEHPGLIEPDHYDISATGVGVVEADNVL
GPDRVKPGDVIIAMGSSGLHSNGYSLVRKVLLEIDRMNLAGHVEEFGRTLGEELLEPTRI
YAKDCLALAAETRVRTFCHVTGGGLAGNLQRVIPHGLIAEVDRGTWTPAPVFTMIAQRGR
VRRTEMEKTFNMGVGMIAVVAPEDTTRALAVLTARHLDCWVLGTVCKGGKQGPRAKLVGQ
HPRF
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgacggatctcgcaaaaggccccggaaaagacccgggtagtcggggtatcacctacgcg
tcggccggggtcgacatcgaagccggtgaccgcgccatcgacctgttcaagccgctcgct
tcgaaggccaccagacccgaagtgcgcggcgggctggggggattcgccggactgttcact
ctccgcggtgactaccgcgaaccggtgctggcggcctccagcgacggcgtcggcaccaaa
ctcgcgatcgctcaggcgatggataagcacgacacggtgggcctggacctggtggcgatg
gtggtcgatgacttggtggtttgcggcgccgagccgctgttcctgttggattacatcgcc
gtcggtcggatcgtgccggagcgactcagcgcgatcgtcgccggtatcgccgatgggtgc
atgcgtgccggctgtgcgctgcttggcggcgagaccgcagaacatccgggcctgatcgag
cccgatcactacgatatctctgccaccggcgtcggcgtcgtcgaggcggacaatgtgctg
ggtcccgaccgggtcaaacccggcgacgtcatcatcgcgatgggctcgtcgggtctgcat
tccaatgggtactcgctggtccgcaaggtgttgctggagatcgaccggatgaatctggcc
ggtcatgtggaggagttcggtcgcaccttgggcgaagagttattggagccgactcgcatc
tacgccaaagactgtttggccttggccgccgaaacccgtgtccggacgttttgccacgtc
accggcggcgggctcgccggcaacctgcaacgggtcatcccgcatggcctcatcgccgag
gtcgaccgcggcacctggacacccgcgccggtattcaccatgattgcccagcgcggccgg
gtcaggcgcacagagatggagaagacgttcaacatgggtgtcggcatgatcgccgtcgtt
gcccccgaagacacgacgcgcgccctggccgtcctgaccgcgcggcacctggactgctgg
gtattgggaaccgtctgcaaaggcggaaaacaaggcccgcgggcaaaactggttgggcag
cacccgagattctaa

DBGET integrated database retrieval system