KEGG   Mycobacterium tuberculosis H37Rv: Rv0819Help
Entry
Rv0819            CDS       T00015                                 

Gene name
mshD
Definition
(RefSeq) mycothiol acetyltransferase
  KO
K15520  mycothiol synthase [EC:2.3.1.189]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Rv0819 (mshD)
Enzymes [BR:mtu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.189  mycothiol synthase
     Rv0819 (mshD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_1 Acetyltransf_7 FR47 Acetyltransf_10 Acetyltransf_3 Acetyltransf_CG Acetyltransf_9
Motif
Other DBs
NCBI-GeneID: 885251
NCBI-ProteinID: NP_215334
TubercuList: Rv0819
UniProt: P9WJM7 I6XWC6
Structure
PDB: 

Position
911736..912683
Genome map
AA seq 315 aa AA seqDB search
MTALDWRSALTADEQRSVRALVTATTAVDGVAPVGEQVLRELGQQRTEHLLVAGSRPGGP
IIGYLNLSPPRGAGGAMAELVVHPQSRRRGIGTAMARAALAKTAGRNQFWAHGTLDPARA
TASALGLVGVRELIQMRRPLRDIPEPTIPDGVVIRTYAGTSDDAELLRVNNAAFAGHPEQ
GGWTAVQLAERRGEAWFDPDGLILAFGDSPRERPGRLLGFHWTKVHPDHPGLGEVYVLGV
DPAAQRRGLGQMLTSIGIVSLARRLGGRKTLDPAVEPAVLLYVESDNVAAVRTYQSLGFT
TYSVDTAYALAGTDN
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
gtgacggcgcttgactggcgctccgctctgaccgccgacgagcagcgcagcgtgcgtgca
ctggtcacggcgacaacagcagtcgatggggtagcacccgtgggtgaacaggtgctgcgg
gaactgggccagcaacgcaccgagcatctgctggtggccggttcgcgaccgggcggcccg
atcatcggctacctcaacctcagcccaccccggggcgcgggtggtgcgatggcggagttg
gtggtgcatccgcagtctcgacggcgcggtatcggcaccgccatggcccgcgcggcattg
gccaagaccgccggccgcaaccagttctgggcgcacggcacgctggatcccgctcgggcg
accgcgtccgcgctgggtctggtcggcgtccgcgaactgatccagatgcgacgcccgctg
cgtgatatccccgaaccgacgatccccgacggggtggtgatccgcacctacgcgggcacg
tccgacgacgctgagctactccgggtcaacaacgccgcgttcgccggacacccggaacag
ggtgggtggaccgcggtccagcttgccgagcggcgtggcgaggcgtggttcgatccagac
ggcctgatcttggccttcggtgattcgccacgtgaacggcctggccggttgctgggtttc
cattggaccaaagtgcatcccgatcacccgggattgggcgaggtgtacgtgctgggcgtc
gatccggcggcgcagcgccgcggtctcggccagatgttgacgtcgatcggtatcgtctcg
ctggcccgtcggctgggcggtcggaagaccctcgaccctgcggtcgaacccgccgtgctg
ctctacgtggagtcggacaatgtggcggccgtgcgaacctaccagagcctgggcttcacc
acctacagcgtcgataccgcctacgcgctggctggcacggataactga

DBGET integrated database retrieval system