KEGG   Mycobacterium tuberculosis H37Rv: Rv0884cHelp
Entry
Rv0884c           CDS       T00015                                 

Gene name
serC
Definition
(RefSeq) phosphoserine aminotransferase
  KO
K00831  phosphoserine aminotransferase [EC:2.6.1.52]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00260  Glycine, serine and threonine metabolism
mtu00680  Methane metabolism
mtu00750  Vitamin B6 metabolism
mtu01100  Metabolic pathways
mtu01120  Microbial metabolism in diverse environments
mtu01130  Biosynthesis of antibiotics
mtu01200  Carbon metabolism
mtu01230  Biosynthesis of amino acids
Module
mtu_M00020  Serine biosynthesis, glycerate-3P => serine
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    Rv0884c (serC)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rv0884c (serC)
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Rv0884c (serC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mtu01007]
    Rv0884c (serC)
Enzymes [BR:mtu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.52  phosphoserine transaminase
     Rv0884c (serC)
Amino acid related enzymes [BR:mtu01007]
 Aminotransferase (transaminase)
  Class V
   Rv0884c (serC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5
Motif
Other DBs
NCBI-GeneID: 885140
NCBI-ProteinID: NP_215399
TubercuList: Rv0884c
UniProt: P9WQ73 I6XA12
Structure
PDB: 

Position
complement(981424..982554)
Genome map
AA seq 376 aa AA seqDB search
MADQLTPHLEIPTAIKPRDGRFGSGPSKVRLEQLQTLTTTAAALFGTSHRQAPVKNLVGR
VRSGLAELFSLPDGYEVILGNGGATAFWDAAAFGLIDKRSLHLTYGEFSAKFASAVSKNP
FVGEPIIITSDPGSAPEPQTDPSVDVIAWAHNETSTGVAVAVRRPEGSDDALVVIDATSG
AGGLPVDIAETDAYYFAPQKNFASDGGLWLAIMSPAALSRIEAIAATGRWVPDFLSLPIA
VENSLKNQTYNTPAIATLALLAEQIDWLVGNGGLDWAVKRTADSSQRLYSWAQERPYTTP
FVTDPGLRSQVVGTIDFVDDVDAGTVAKILRANGIVDTEPYRKLGRNQLRVAMFPAVEPD
DVSALTECVDWVVERL
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggccgaccagctcaccccccacctggaaattcccaccgccatcaaaccccgcgacggc
cgctttgggtcgggcccgtcgaaggtccggcttgagcaactgcaaacgctgaccaccacc
gcagcggcattgttcggcacgtcgcaccgacaggcgccggtcaagaatctggtgggcagg
gttcggtcaggcctggccgagctgttctcgttgccggacggctatgaggtgatactgggc
aatggtggtgccacggcgttctgggatgcggccgccttcgggctgattgacaaacgctca
ctgcacttgacttacggcgagttcagcgcgaagttcgcttccgccgtttccaagaacccg
ttcgtcggcgagccgatcatcatcacgtcggatcccggcagtgctccggagccgcaaacc
gacccgtcagtcgatgtgatcgcctgggcccacaacgagacctcgaccggggtcgcggtt
gcggtgcgccgtccggagggctccgatgacgccttggtcgtcatcgacgccacctccggt
gctggcggcctaccggtcgacatcgccgagaccgacgcctactacttcgcaccgcagaag
aacttcgccagcgacggcggcctgtggctggccatcatgagcccggccgccctgagccgg
atcgaggccatcgccgcgaccggtcgctgggttcctgatttcctgtccctgccgatcgcg
gtcgagaacagcttgaagaaccagacatacaacacaccggccatcgccacgctggcgctg
ctggccgaacagatcgactggctggtgggtaacggtggcttggactgggcggtcaaacgc
accgcggactcgtcgcagcggttgtactcgtgggcgcaagagcggccctacaccacgcca
tttgtcaccgaccccgggttgcggtcgcaggtggtgggcacgatcgacttcgtcgacgac
gtcgacgccgggaccgtcgcgaagatcctgcgggctaacggcatcgtcgacaccgagccg
tatcgcaaactgggccgaaaccagctgcgggtcgcgatgttccccgcggtcgagccggac
gacgtcagcgccctcaccgagtgcgtcgactgggtggtcgagcggctttag

DBGET integrated database retrieval system