KEGG   Mycobacterium tuberculosis H37Rv: Rv0896Help
Entry
Rv0896            CDS       T00015                                 

Gene name
gltA2
Definition
(RefSeq) citrate synthase 1
  KO
K01647  citrate synthase [EC:2.3.3.1]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00020  Citrate cycle (TCA cycle)
mtu00630  Glyoxylate and dicarboxylate metabolism
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01120  Microbial metabolism in diverse environments
mtu01130  Biosynthesis of antibiotics
mtu01200  Carbon metabolism
mtu01210  2-Oxocarboxylic acid metabolism
mtu01230  Biosynthesis of amino acids
Module
mtu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mtu_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
mtu_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Rv0896 (gltA2)
   00630 Glyoxylate and dicarboxylate metabolism
    Rv0896 (gltA2)
Enzymes [BR:mtu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.1  citrate (Si)-synthase
     Rv0896 (gltA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Citrate_synt
Motif
Other DBs
NCBI-GeneID: 885208
NCBI-ProteinID: NP_215411
TubercuList: Rv0896
UniProt: P9WPD5 I6XWI3
Structure
PDB: 

Position
999472..1000767
Genome map
AA seq 431 aa AA seqDB search
MADTDDTATLRYPGGEIDLQIVHATEGADGIALGPLLAKTGHTTFDVGFANTAAAKSSIT
YIDGDAGILRYRGYPIDQLAEKSTFIEVCYLLIYGELPDTDQLAQFTGRIQRHTMLHEDL
KRFFDGFPRNAHPMPVLSSVVNALSAYYQDALDPMDNGQVELSTIRLLAKLPTIAAYAYK
KSVGQPFLYPDNSLTLVENFLRLTFGFPAEPYQADPEVVRALDMLFILHADHEQNCSTST
VRLVGSSRANLFTSISGGINALWGPLHGGANQAVLEMLEGIRDSGDDVSEFVRKVKNREA
GVKLMGFGHRVYKNYDPRARIVKEQADKILAKLGGDDSLLGIAKELEEAALTDDYFIERK
LYPNVDFYTGLIYRALGFPTRMFTVLFALGRLPGWIAHWREMHDEGDSKIGRPRQIYTGY
TERDYVTIDAR
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
gtggccgacaccgacgacaccgcaaccctccgttacccgggaggcgagatcgacctgcag
atcgtgcacgccaccgaaggcgccgacggcattgcgctcgggccgctgctggcaaaaacc
gggcacaccacgttcgacgtcggcttcgccaacacggccgccgctaaaagctccatcacc
tacatcgacggagatgccggcattctgcgttatcgcggctacccgatcgaccaactggcg
gagaagtcaaccttcatcgaggtctgctacctgttgatttacggcgagctgcccgatacc
gaccagcttgcccagttcaccggccggatccagcgccacaccatgctgcacgaggatctc
aagcggttcttcgacggctttccgcgcaatgcccacccgatgccggtgttgtccagcgtg
gtcaatgcgctgtcggcgtactaccaggatgctctggaccccatggacaacggtcaagtc
gagctgtcgaccattcggctgctggccaagctgcccaccatcgccgcgtacgcctacaag
aaatcggtcggccagcccttcctctacccagataactcactgacgctggtggagaacttc
ctacggttgacgttcggatttcccgccgagccctaccaggccgaccccgaggtggtgcgg
gcgctggacatgttgttcatcttgcacgccgaccacgagcagaactgctcgacgtcgacg
gttcggctggttggctcgtcgcgagccaacctgttcacctcgatctcgggtggcatcaac
gcactatggggtccgcttcatggcggcgccaatcaggctgtcctggagatgctcgagggc
attcgcgacagcggcgacgacgtcagcgagtttgtacgcaaggtcaagaaccgcgaggcc
ggggtcaaattgatgggtttcggtcatcgtgtctacaagaactacgatccgcgggcccgc
atcgtcaaggaacaggccgacaagatcctggccaagctcggcggcgatgactccttgctg
ggcatcgccaaggagctcgaagaggcggcgctgaccgacgactacttcatcgaacgcaag
ctttaccccaacgtcgacttctacaccggcctgatctaccgggccctcggcttcccgacc
aggatgttcaccgtgttgtttgccctgggcaggcttcccggctggatcgcgcactggcgt
gagatgcacgacgagggcgacagcaagatcggccggccccgccagatctacaccggctac
acggagcgcgactacgtcaccatagacgcgcggtag

DBGET integrated database retrieval system