KEGG   Mycobacterium tuberculosis H37Rv: Rv0934Help
Entry
Rv0934            CDS       T00015                                 

Gene name
pstS1
Definition
(RefSeq) phosphate ABC transporter substrate-binding lipoprotein PstS
  KO
K02040  phosphate transport system substrate-binding protein
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu02010  ABC transporters
mtu02020  Two-component system
mtu05152  Tuberculosis
Module
mtu_M00222  Phosphate transport system
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Rv0934 (pstS1)
  09132 Signal transduction
   02020 Two-component system
    Rv0934 (pstS1)
 09160 Human Diseases
  09171 Infectious diseases: Bacterial
   05152 Tuberculosis
    Rv0934 (pstS1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mtu02000]
    Rv0934 (pstS1)
Transporters [BR:mtu02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Phosphate transporter [MD:M00222] [OT]
    Rv0934 (pstS1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PBP_like_2 SBP_bac_1 PBP_like
Motif
Other DBs
NCBI-GeneID: 885724
NCBI-ProteinID: YP_177770
TubercuList: Rv0934
UniProt: P9WGU1 I6XA55
Structure
PDB: 

Position
1042115..1043239
Genome map
AA seq 374 aa AA seqDB search
MKIRLHTLLAVLTAAPLLLAAAGCGSKPPSGSPETGAGAGTVATTPASSPVTLAETGSTL
LYPLFNLWGPAFHERYPNVTITAQGTGSGAGIAQAAAGTVNIGASDAYLSEGDMAAHKGL
MNIALAISAQQVNYNLPGVSEHLKLNGKVLAAMYQGTIKTWDDPQIAALNPGVNLPGTAV
VPLHRSDGSGDTFLFTQYLSKQDPEGWGKSPGFGTTVDFPAVPGALGENGNGGMVTGCAE
TPGCVAYIGISFLDQASQRGLGEAQLGNSSGNFLLPDAQSIQAAAAGFASKTPANQAISM
IDGPAPDGYPIINYEYAIVNNRQKDAATAQTLQAFLHWAITDGNKASFLDQVHFQPLPPA
VVKLSDALIATISS
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaattcgtttgcatacgctgttggccgtgttgaccgctgcgccgctgctgctagca
gcggcgggctgtggctcgaaaccaccgagcggttcgcctgaaacgggcgccggcgccggt
actgtcgcgactacccccgcgtcgtcgccggtgacgttggcggagaccggtagcacgctg
ctctacccgctgttcaacctgtggggtccggcctttcacgagaggtatccgaacgtcacg
atcaccgctcagggcaccggttctggtgccgggatcgcgcaggccgccgccgggacggtc
aacattggggcctccgacgcctatctgtcggaaggtgatatggccgcgcacaaggggctg
atgaacatcgcgctagccatctccgctcagcaggtcaactacaacctgcccggagtgagc
gagcacctcaagctgaacggaaaagtcctggcggccatgtaccagggcaccatcaaaacc
tgggacgacccgcagatcgctgcgctcaaccccggcgtgaacctgcccggcaccgcggta
gttccgctgcaccgctccgacgggtccggtgacaccttcttgttcacccagtacctgtcc
aagcaagatcccgagggctggggcaagtcgcccggcttcggcaccaccgtcgacttcccg
gcggtgccgggtgcgctgggtgagaacggcaacggcggcatggtgaccggttgcgccgag
acaccgggctgcgtggcctatatcggcatcagcttcctcgaccaggccagtcaacgggga
ctcggcgaggcccaactaggcaatagctctggcaatttcttgttgcccgacgcgcaaagc
attcaggccgcggcggctggcttcgcatcgaaaaccccggcgaaccaggcgatttcgatg
atcgacgggcccgccccggacggctacccgatcatcaactacgagtacgccatcgtcaac
aaccggcaaaaggacgccgccaccgcgcagaccttgcaggcatttctgcactgggcgatc
accgacggcaacaaggcctcgttcctcgaccaggttcatttccagccgctgccgcccgcg
gtggtgaagttgtctgacgcgttgatcgcgacgatttccagctag

DBGET integrated database retrieval system