KEGG   Mycobacterium tuberculosis H37Rv: Rv0946cHelp
Entry
Rv0946c           CDS       T00015                                 

Gene name
pgi
Definition
(RefSeq) glucose-6-phosphate isomerase
  KO
K01810  glucose-6-phosphate isomerase [EC:5.3.1.9]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00010  Glycolysis / Gluconeogenesis
mtu00030  Pentose phosphate pathway
mtu00500  Starch and sucrose metabolism
mtu00520  Amino sugar and nucleotide sugar metabolism
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01120  Microbial metabolism in diverse environments
mtu01130  Biosynthesis of antibiotics
mtu01200  Carbon metabolism
Module
mtu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mtu_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rv0946c (pgi)
   00030 Pentose phosphate pathway
    Rv0946c (pgi)
   00500 Starch and sucrose metabolism
    Rv0946c (pgi)
   00520 Amino sugar and nucleotide sugar metabolism
    Rv0946c (pgi)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mtu04147]
    Rv0946c (pgi)
Enzymes [BR:mtu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.9  glucose-6-phosphate isomerase
     Rv0946c (pgi)
Exosome [BR:mtu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Rv0946c (pgi)
  Exosomal proteins of other body fluids (saliva and urine)
   Rv0946c (pgi)
  Exosomal proteins of colorectal cancer cells
   Rv0946c (pgi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGI
Motif
Other DBs
NCBI-GeneID: 885533
NCBI-ProteinID: NP_215461
TubercuList: Rv0946c
UniProt: P9WN69 I6WZU7
Structure
PDB: 

Position
complement(1055024..1056685)
Genome map
AA seq 553 aa AA seqDB search
MTSAPIPDITATPAWDALRRHHDQIGNTHLRQFFADDPGRGRELTVSVGDLYIDYSKHRV
TRETLALLIDLARTAHLEERRDQMFAGVHINTSEDRAVLHTALRLPRDAELVVDGQDVVT
DVHAVLDAMGAFTDRLRSGEWTGATGKRISTVVNIGIGGSDLGPVMVYQALRHYADAGIS
ARFVSNVDPADLIATLADLDPATTLFIVASKTFSTLETLTNATAARRWLTDALGDAAVSR
HFVAVSTNKRLVDDFGINTDNMFGFWDWVGGRYSVDSAIGLSLMTVIGRDAFADFLAGFH
IIDRHFATAPLESNAPVLLGLIGLWYSNFFGAQSRTVLPYSNDLSRFPAYLQQLTMESNG
KSTRADGSPVSADTGEIFWGEPGTNGQHAFYQLLHQGTRLVPADFIGFAQPLDDLPTAEG
TGSMHDLLMSNFFAQTQVLAFGKTAEEIAADGTPAHVVAHKVMPGNRPSTSILASRLTPS
VLGQLIALYEHQVFTEGVVWGIDSFDQWGVELGKTQAKALLPVITGAGSPPPQSDSSTDG
LVRRYRTERGRAG
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgacctccgcgccaatccccgacatcaccgctaccccggcatgggacgccctgcgcaga
catcacgatcagatcggaaacacccatcttcgccagttcttcgccgacgatccgggtcgc
ggccgggagctcaccgtcagcgtcggcgatctctacatcgactacagcaaacaccgcgtc
acccgcgagacgctggcgctgctgatcgatctggcccggacggcccacctcgaagagcgt
cgcgaccagatgttcgccggtgtgcatatcaacacctctgaggatcgagcggtgttgcac
accgcgctgcggctgccccgagacgccgaactcgtcgtcgacggccaagacgtcgtcacc
gacgtacatgccgtgctcgacgcgatgggcgccttcaccgaccgcctgcgcagcggcgag
tggaccggagcaactggaaagcggatcagcaccgtcgtcaacatcggcatcggtggttcg
gatttgggtccggtgatggtgtaccaagcgttgcgccactatgccgacgcgggcatttcc
gcgcgcttcgtgtccaacgtcgatcccgccgacctgatcgccacgctcgccgatctagac
cccgccacaacgcttttcatcgtcgcgtcgaagacgttctcgacgctggagacattgacc
aatgcgaccgcggcgcgtcgctggctgaccgatgcgctgggcgacgccgcggtgtcgcgg
cattttgtcgcggtgtccaccaacaagcgcctggtcgacgacttcggcatcaacaccgac
aacatgttcggtttttgggattgggtcggcgggcgttattcggtggattcggcgatcggg
ctgtcgttgatgacggtgatcggccgcgacgccttcgccgatttcttggccggattccac
atcatcgaccgccatttcgcgaccgctccgctggaatccaacgcgccggtgctgcttggc
ctgatcggactgtggtactccaatttcttcggtgcgcaatcacgcaccgtgctgccgtat
tccaatgacttgtcgcgttttccggcctaccttcagcagttgaccatggaatccaacggc
aagtccacgcgcgccgacggcagcccggtcagcgccgacaccggtgaaatcttttggggt
gaaccgggaaccaacggccagcacgccttctaccagttgctgcaccagggcacccggctg
gtgccagccgatttcatcggctttgctcaacccctcgacgacctgccgaccgccgagggc
accggcagcatgcatgatctgctgatgagcaacttcttcgcccaaacccaggtgctggcg
ttcggcaagaccgccgaggagatcgccgccgacggcacccccgcccacgtggtagcgcat
aaggtgatgcccggcaaccggccgtccacctcaattctggccagtcggctcacgccgtcg
gtgctggggcagttgatcgcgctctacgagcatcaggtgttcaccgagggtgtggtgtgg
ggtatcgactcgttcgaccagtggggggtggagctgggcaagacgcaggccaaggcgctg
cttccggtaatcaccggcgccggttcaccgccaccgcagtcggacagctcgaccgacggg
ctggtgcgccgctaccgcaccgaacgtggccgcgcgggctag

DBGET integrated database retrieval system