KEGG   Mycobacterium tuberculosis H37Rv: Rv0952Help
Entry
Rv0952            CDS       T00015                                 

Gene name
sucD
Definition
(RefSeq) succinyl-CoA ligase subunit alpha
  KO
K01902  succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00020  Citrate cycle (TCA cycle)
mtu00640  Propanoate metabolism
mtu00660  C5-Branched dibasic acid metabolism
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01120  Microbial metabolism in diverse environments
mtu01130  Biosynthesis of antibiotics
mtu01200  Carbon metabolism
Module
mtu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mtu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Rv0952 (sucD)
   00640 Propanoate metabolism
    Rv0952 (sucD)
   00660 C5-Branched dibasic acid metabolism
    Rv0952 (sucD)
Enzymes [BR:mtu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Rv0952 (sucD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 885426
NCBI-ProteinID: NP_215467
TubercuList: Rv0952
UniProt: P9WGC7
Position
1063140..1064051
Genome map
AA seq 303 aa AA seqDB search
MTHMSIFLSRDNKVIVQGITGSEATVHTARMLRAGTQIVGGVNARKAGTTVTHEDKGGRL
IKLPVFGSVAEAMEKTGADVSIIFVPPTFAKDAIIEAIDAEIPLLVVITEGIPVQDTAYA
WAYNLEAGHKTRIIGPNCPGIISPGQSLAGITPANITGPGPIGLVSKSGTLTYQMMFELR
DLGFSTAIGIGGDPVIGTTHIDAIEAFERDPDTKLIVMIGEIGGDAEERAADFIKTNVSK
PVVGYVAGFTAPEGKTMGHAGAIVSGSSGTAAAKQEALEAAGVKVGKTPSATAALAREIL
LSL
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgactcacatgtccatatttctgagcagggacaacaaggtcattgtgcagggcatcacc
ggcagtgaggccaccgtccataccgcgcgaatgctgcgggcgggcacgcaaatcgtcggc
ggtgtgaacgcacgcaaagcgggcaccaccgtcacgcatgaggataagggcggccggctg
atcaagctgccggtgttcggcagtgtcgcggaggcgatggaaaagaccggcgccgatgtg
tcgatcatcttcgtgccgccgacgttcgccaaggacgccatcatcgaggccatcgacgcc
gaaattccgctgttggttgtgatcaccgagggaattccggtgcaggacaccgcctatgcc
tgggcctacaacctcgaggctggccacaagacccgcatcattggccccaactgtcctggc
attatcagtcccggtcagtcgctggccggtatcacgccggccaacatcaccggacccggt
ccaattggtctggtgtccaagtcggggacgttgacctaccagatgatgttcgaactgcgc
gaccttggattctccacggcgatcggcatcggtggtgatccggtgattggcactacccac
atcgacgccatcgaggccttcgagagggatccggacaccaagctcatcgtgatgatcggc
gagatcggtggtgacgccgaggagcgggccgcagacttcatcaagaccaacgtgtccaag
ccggtcgtcggctatgtcgccggatttaccgcacccgaaggcaagacgatgggccacgcc
ggcgccatcgtctccggctcgtctggcacagcggcggccaagcaagaggccctggaggcc
gccggtgtgaaggtcggcaagaccccatcggcgaccgcggcgctggcccgggagatcttg
ctcagtctctag

DBGET integrated database retrieval system