KEGG   Mycobacterium tuberculosis H37Rv: Rv0956Help
Entry
Rv0956            CDS       T00015                                 

Gene name
purN
Definition
(RefSeq) phosphoribosylglycinamide formyltransferase PurN
  KO
K11175  phosphoribosylglycinamide formyltransferase 1 [EC:2.1.2.2]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00230  Purine metabolism
mtu00670  One carbon pool by folate
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01130  Biosynthesis of antibiotics
Module
mtu_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Rv0956 (purN)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Rv0956 (purN)
Enzymes [BR:mtu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.2  phosphoribosylglycinamide formyltransferase
     Rv0956 (purN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Formyl_trans_N DUF2000
Motif
Other DBs
NCBI-GeneID: 885407
NCBI-ProteinID: NP_215471
TubercuList: Rv0956
UniProt: P9WHM5 I6Y590
Structure
PDB: 

Position
1067561..1068208
Genome map
AA seq 215 aa AA seqDB search
MQEPLRVPPSAPARLVVLASGTGSLLRSLLDAAVGDYPARVVAVGVDRECRAAEIAAEAS
VPVFTVRLADHPSRDAWDVAITAATAAHEPDLVVSAGFMRILGPQFLSRFYGRTLNTHPA
LLPAFPGTHGVADALAYGVKVTGATVHLVDAGTDTGPILAQQPVPVLDGDDEETLHERIK
VTERRLLVAAVAALATHGVTVVGRTATMGRKVTIG
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
gtgcaggaaccgcttcgtgtacccccgagtgcacctgcgcggctggtagtactcgcgtct
ggcaccggttcgttgctgagatctctactcgatgccgctgtcggcgactacccggcacgg
gtagtcgccgttggtgtggatcgcgaatgccgggccgccgaaatcgccgcggaagcatcg
gtgccggtgttcaccgttcggctcgccgaccaccccagtcgcgatgcctgggacgtcgcc
atcaccgccgccaccgcagcccatgagcccgacctcgtcgtttctgcgggctttatgaga
atccttggaccgcagttcctttcacgattctacgggcgcaccctcaacacccacccggcg
ctgctgccggccttccccggcacgcacggtgtcgctgacgcgctggcctacggggtgaag
gtcaccggcgctacggtgcacctggtagacgctggcacggacaccgggccaatactggcg
cagcaacctgtgccggtgctcgacggtgacgacgaagagactttgcatgaacgaatcaag
gtcaccgaacgacggctgttggtagcggcggtggccgcactggccacccatggcgtgacg
gtggtcggacgaacagcgacgatgggacgaaaggtaaccataggatga

DBGET integrated database retrieval system