KEGG   Mycobacterium tuberculosis H37Rv: Rv0993Help
Entry
Rv0993            CDS       T00015                                 

Gene name
galU
Definition
(RefSeq) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00040  Pentose and glucuronate interconversions
mtu00052  Galactose metabolism
mtu00500  Starch and sucrose metabolism
mtu00520  Amino sugar and nucleotide sugar metabolism
mtu01100  Metabolic pathways
mtu01130  Biosynthesis of antibiotics
Module
mtu_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Rv0993 (galU)
   00052 Galactose metabolism
    Rv0993 (galU)
   00500 Starch and sucrose metabolism
    Rv0993 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    Rv0993 (galU)
Enzymes [BR:mtu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Rv0993 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Imm75
Motif
Other DBs
NCBI-GeneID: 885341
NCBI-ProteinID: NP_215508
TubercuList: Rv0993
UniProt: A0A089QQP3 O05576
Position
1109272..1110192
Genome map
AA seq 306 aa AA seqDB search
MSRPEVLTPFTAIVPAAGLGTRFLPATKTVPKELLPVVDTPGIELVAAEAAAAGAERLVI
VTSEGKDGVVAHFVEDLVLEGTLEARGKIAMLAKVRRAPALIKVESVVQAEPLGLGHAIG
CVEPTLSPDEDAVAVLLPDDLVLPTGVLETMSKVRASRGGTVLCAIEVAREEISAYGVFD
VEPVPDGDYTDDPNVLKVRGMVEKPKAETAPSRYAAAGRYVLDRAIFDALRRIDQGAGGE
VQLTDAIALLIAEGHPVHVVVHQGSRHDLGNPGGYLKAAVDFALDRDDYGPDLRRWLVAR
LGLTEQ
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgcccagaagtactaacgccgttcacggcaatcgtcccggcagccggcctgggt
acgcgctttctgccggccaccaagacggtgcccaaggagctgctgcccgtcgtcgacact
cccggtatcgagctggtggccgccgaggcggccgcggccggtgccgaacggctggtgatc
gtcacctccgagggtaaggacggggtggtcgcgcatttcgtggaagacctggtgctggag
ggcacgctcgaggcccgaggcaagatcgccatgctggccaaggtgcgtcgcgccccggca
ctgatcaaggtcgaatccgtggtgcaggccgagccgctgggactgggacacgccatcggc
tgtgtggagccgacgctgtcgcccgacgaagacgctgtcgcggtgctgctgcctgacgac
ctggtgctgccgaccggcgtcctggagacgatgtcgaaggtgcgagccagcaggggcggc
accgtgctgtgtgctatcgaggtggcgcgcgaggagatcagtgcctacggggttttcgat
gtcgagccggtccccgatggtgactacaccgacgatcccaacgtgctgaaggtcaggggc
atggtcgaaaagcccaaggccgaaacggcgccgtcgaggtatgcggcggccggccgctac
gttctagaccgtgccatcttcgatgcgttacgccgcatcgaccagggtgcaggcggtgaa
gtgcagctcaccgatgcgatcgcgctgctgattgccgagggccatcccgtccatgtcgtc
gtccaccaagggtcccgacacgacctgggaaatccgggcgggtacctcaaggctgcggtt
gactttgcattggatcgtgacgactacggcccggacttgcggcgatggttggtggcgcga
ctgggtctgacagagcagtag

DBGET integrated database retrieval system