KEGG   Mycobacterium tuberculosis H37Rv: Rv1001Help
Entry
Rv1001            CDS       T00015                                 

Gene name
arcA
Definition
(RefSeq) arginine deiminase
  KO
K01478  arginine deiminase [EC:3.5.3.6]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00220  Arginine biosynthesis
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    Rv1001 (arcA)
Enzymes [BR:mtu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.6  arginine deiminase
     Rv1001 (arcA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidinotransf
Motif
Other DBs
NCBI-GeneID: 888313
NCBI-ProteinID: NP_215517
TubercuList: Rv1001
UniProt: P9WQ05 I6X008
Position
1117185..1118393
Genome map
AA seq 402 aa AA seqDB search
MGVELGSNSEVGALRVVILHRPGAELRRLTPRNTDQLLFDGLPWVSRAQDEHDEFAELLA
SRGAEVLLLSDLLTEALHHSGAARMQGIAAAVDAPRLGLPLAQELSAYLRSLDPGRLAHV
LTAGMTFNELPSDTRTDVSLVLRMHHGGDFVIEPLPNLVFTRDSSIWIGPRVVIPSLALR
ARVREASLTDLIYAHHPRFTGVRRAYESRTAPVEGGDVLLLAPGVVAVGVGERTTPAGAE
ALARSLFDDDLAHTVLAVPIAQQRAQMHLDTVCTMVDTDTMVMYANVVDTLEAFTIQRTP
DGVTIGDAAPFAEAAAKAMGIDKLRVIHTGMDPVVAEREQWDDGNNTLALAPGVVVAYER
NVQTNARLQDAGIEVLTIAGSELGTGRGGPRCMSCPAARDPL
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
gtgggtgtcgaattggggtcaaattccgaggtcggcgcgctaagagtggtcatcctgcac
cgcccgggggccgaactgcgccggctcacaccgcgcaacaccgaccagctgctgttcgac
ggcctgccctgggtatcccgcgcgcaggacgagcacgacgaattcgccgagctgctggct
tcccgcggtgcggaagtgctgttgctgtcggacctgttgactgaggcactacatcacagc
ggggccgcccgcatgcaggggatcgccgctgccgtcgacgcaccgcggctgggactgccg
ctggcgcaagagctttcggcctacctgcgtagtctcgacccaggcaggttggcgcatgtg
ctgacggccggcatgaccttcaacgagctcccgtcggacacgcggaccgacgtgtcgttg
gtgttgcgtatgcaccatggcggagacttcgtcattgagccgttgccgaacctggtgttc
acccgcgactcgtcgatatggatcgggccgcgggtggtgatcccgtcgctggcattacgg
gcacgggtgcgcgaagcgtcgctgaccgacctcatctatgctcatcacccgcggttcacc
ggtgtgcggcgtgcctatgaatcgcgcaccgctccggtcgagggtggcgacgtgttgttg
ctcgccccgggtgtggtcgctgtcggagtgggcgagcggactacaccagcaggcgcggaa
gcattggcgcgcagcctttttgacgatgatcttgcgcataccgtgctcgccgtgccgatc
gctcagcagcgcgcgcaaatgcatctggacacggtgtgcacgatggtcgacaccgatacg
atggtgatgtacgccaacgttgtcgacacgctcgaggcgttcacgatccagcgcacaccc
gacggcgtgaccatcggcgatgcggccccgttcgcggaggcggctgccaaggcgatggga
atcgacaagctgcgggtaattcataccggaatggaccccgtcgtcgctgaacgcgaacag
tgggacgacggcaacaacacgttggcgttggcgcccggtgtcgttgtcgcctacgagcgc
aacgtacagaccaacgcccgcctgcaggacgcgggcatcgaagtgcttaccatcgccggc
tccgaattgggtaccggccgtggcgggccccgctgcatgtcctgtccggccgcccgcgat
ccgctttag

DBGET integrated database retrieval system