KEGG   Mycobacterium tuberculosis H37Rv: Rv1017cHelp
Entry
Rv1017c           CDS       T00015                                 

Gene name
prsA
Definition
(RefSeq) ribose-phosphate pyrophosphokinase
  KO
K00948  ribose-phosphate pyrophosphokinase [EC:2.7.6.1]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00030  Pentose phosphate pathway
mtu00230  Purine metabolism
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01120  Microbial metabolism in diverse environments
mtu01130  Biosynthesis of antibiotics
mtu01200  Carbon metabolism
mtu01230  Biosynthesis of amino acids
Module
mtu_M00005  PRPP biosynthesis, ribose 5P => PRPP
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Rv1017c (prsA)
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Rv1017c (prsA)
Enzymes [BR:mtu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.1  ribose-phosphate diphosphokinase
     Rv1017c (prsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pribosyltran_N Pribosyl_synth Pribosyltran UPRTase PRTase_2
Motif
Other DBs
NCBI-GeneID: 885993
NCBI-ProteinID: NP_215533
TubercuList: Rv1017c
UniProt: P9WKE3 I6Y5E8
Position
complement(1135501..1136481)
Genome map
AA seq 326 aa AA seqDB search
MSHDWTDNRKNLMLFAGRAHPELAEQVAKELDVHVTSQDAREFANGEIFVRFHESVRGCD
AFVLQSCPAPVNRWLMEQLIMIDALKRGSAKRITAVMPFYPYARQDKKHRGREPISARLI
ADLLKTAGADRIVTVDLHTDQIQGFFDGPVDHMRGQNLLTGYIRDNYPDGNMVVVSPDSG
RVRIAEKWADALGGVPLAFIHKTRDPRVPNQVVSNRVVGDVAGRTCVLIDDMIDTGGTIA
GAVALLHNDGAGDVIIAATHGVLSDPAAQRLASCGAREVIVTNTLPIGEDKRFPQLTVLS
IAPLLASTIRAVFENGSVTGLFDGDA
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
ttgagccacgactggaccgataatcgcaaaaacctgatgctctttgccggccgcgcccat
ccggagctggccgagcaggtagccaaagagctcgacgtccacgtcacctctcaggacgcg
cgggagttcgccaacggcgagatcttcgtgcgcttccacgaatcggtacgcggttgcgac
gccttcgtcctgcaatcctgcccggcaccggtgaacaggtggctgatggaacagctgatc
atgatcgacgcgctcaaacggggcagcgccaaacggatcaccgccgtcatgccgttctat
ccgtatgcccggcaagacaagaaacaccgtggccgcgaaccgatctccgcgcgactgatc
gccgacctgctcaagaccgcgggcgccgaccggatcgtgacggtcgacctgcacaccgac
cagatccagggtttcttcgacgggccggtcgatcatatgcgcggtcagaacctgctgacc
ggttacatcagagacaactacccggacggcaacatggtggtcgtctcccctgactccggc
cgggtacgcatcgccgagaagtgggccgacgcattaggtggtgttcccctcgccttcatc
cacaagacccgtgatccgcgggtacccaaccaagtggtgtccaaccgcgtcgtcggcgac
gtggccgggcgcacctgtgtcctgattgacgacatgatcgacaccggcggcaccatcgcc
ggcgcggtggcattgctgcacaacgacggcgccggtgacgtgatcatcgcggcaacccac
ggcgtgctctccgaccccgctgcgcagcggctggcctcctgcggcgcccgcgaagtgatc
gtcacgaacacgctcccgatcggcgaagacaagcgcttcccccagctcaccgttttgtcc
atcgcgccgctgctggccagcacaatccgggcggtcttcgaaaacggctcagtaacagga
cttttcgacggggacgcatag

DBGET integrated database retrieval system