KEGG   Mycobacterium tuberculosis H37Rv: Rv1018cHelp
Entry
Rv1018c           CDS       T00015                                 

Gene name
glmU
Definition
(RefSeq) bifunctional UDP-N-acetylglucosamine pyrophosphorylase/glucosamine-1-phosphate N-acetyltransferase
  KO
K04042  bifunctional UDP-N-acetylglucosamine pyrophosphorylase / Glucosamine-1-phosphate N-acetyltransferase [EC:2.7.7.23 2.3.1.157]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00520  Amino sugar and nucleotide sugar metabolism
mtu01100  Metabolic pathways
mtu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Rv1018c (glmU)
Enzymes [BR:mtu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.157  glucosamine-1-phosphate N-acetyltransferase
     Rv1018c (glmU)
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.23  UDP-N-acetylglucosamine diphosphorylase
     Rv1018c (glmU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexapep NTP_transf_3 NTP_transferase IspD Hexapep_2 CTP_transf_3
Motif
Other DBs
NCBI-GeneID: 886069
NCBI-ProteinID: NP_215534
TubercuList: Rv1018c
UniProt: P9WMN3 I6XWU3
Structure
PDB: 

Position
complement(1136573..1138060)
Genome map
AA seq 495 aa AA seqDB search
MTFPGDTAVLVLAAGPGTRMRSDTPKVLHTLAGRSMLSHVLHAIAKLAPQRLIVVLGHDH
QRIAPLVGELADTLGRTIDVALQDRPLGTGHAVLCGLSALPDDYAGNVVVTSGDTPLLDA
DTLADLIATHRAVSAAVTVLTTTLDDPFGYGRILRTQDHEVMAIVEQTDATPSQREIREV
NAGVYAFDIAALRSALSRLSSNNAQQELYLTDVIAILRSDGQTVHASHVDDSALVAGVNN
RVQLAELASELNRRVVAAHQLAGVTVVDPATTWIDVDVTIGRDTVIHPGTQLLGRTQIGG
RCVVGPDTTLTDVAVGDGASVVRTHGSSSSIGDGAAVGPFTYLRPGTALGADGKLGAFVE
VKNSTIGTGTKVPHLTYVGDADIGEYSNIGASSVFVNYDGTSKRRTTVGSHVRTGSDTMF
VAPVTIGDGAYTGAGTVVREDVPPGALAVSAGPQRNIENWVQRKRPGSPAAQASKRASEM
ACQQPTQPPDADQTP
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgacgtttcctggtgacaccgcggtcctggtcctagcggccgggcccgggacccggatg
cgttcggacacccccaaggtgctgcacacactcgccggtcgcagcatgctgtcgcatgta
ctgcatgcgatcgccaagctggcgccgcagcgtctaatcgtggtgctgggacacgatcac
cagcgcatcgcgccgctagtcggtgaactcgccgacaccctaggccgaacgatcgacgtc
gccctgcaggatcgaccgctagggaccgggcatgcggtactctgcgggctgtccgcgctg
cccgatgactacgccggcaacgtcgtggtcacctcgggagataccccgctgctggacgcc
gacacgctggccgacttgatcgccacccaccgcgcggtgtcggctgcggtgacggtgctg
accacgacgctggatgatcccttcggctacggccgcatcctgcgcacccaggatcacgaa
gtcatggcgatcgtggagcaaaccgacgcgacaccatcgcagcgggaaatccgcgaagtc
aacgccggcgtctacgccttcgacatcgccgcgctgcggtccgcactgagccggctgagc
tccaacaacgcccaacaggagctctacctcaccgacgtcatcgccatcttgcgctccgac
ggccagaccgtacatgccagccacgtcgacgacagcgcgttggtggccggcgtcaacaat
cgcgtccagctggccgagctggcctccgaactcaaccggcgggtggtggccgctcaccag
ctggccggcgtcaccgtcgtcgacccggctaccacctggatcgacgtcgacgtcaccatc
ggccgcgacaccgtcattcacccgggtacccagttgctgggccgcacccagatcggcggt
cgctgtgtcgtcggtcccgacaccaccctgaccgacgtcgccgtcggcgacggtgcctcg
gtggtgcgcacccacggttcgtcgtcgtcgattggggatggcgccgcggtcgggcccttc
acctacctgcggcccggaaccgcgttgggcgccgacggcaagctgggcgcgttcgtcgag
gtcaagaactccaccatcggcaccggcaccaaggtgccgcacctgacctacgtcggcgac
gccgacatcggcgagtacagcaacatcggcgcctccagcgtgttcgtcaactacgacggt
acgtccaaacggcgcaccaccgtcggttcgcacgtacggaccgggtccgacaccatgttc
gtggccccagtaaccatcggcgacggcgcgtataccggggccggcacagtggtgcgggag
gatgtcccgccgggggcgctggcagtgtcggcgggtccgcaacgcaacatcgagaactgg
gtgcagcgcaaacgccccggcagcccagcggctcaggcctcaaaaagagcctcagaaatg
gcctgccaacagcccacacaaccacccgacgctgatcagacaccgtga

DBGET integrated database retrieval system