KEGG   Mycobacterium tuberculosis H37Rv: Rv1023Help
Entry
Rv1023            CDS       T00015                                 

Gene name
eno
Definition
(RefSeq) enolase
  KO
K01689  enolase [EC:4.2.1.11]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00010  Glycolysis / Gluconeogenesis
mtu00680  Methane metabolism
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01120  Microbial metabolism in diverse environments
mtu01130  Biosynthesis of antibiotics
mtu01200  Carbon metabolism
mtu01230  Biosynthesis of amino acids
mtu03018  RNA degradation
Module
mtu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mtu_M00002  Glycolysis, core module involving three-carbon compounds
mtu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rv1023 (eno)
  09102 Energy metabolism
   00680 Methane metabolism
    Rv1023 (eno)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    Rv1023 (eno)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mtu03019]
    Rv1023 (eno)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mtu04147]
    Rv1023 (eno)
Enzymes [BR:mtu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.11  phosphopyruvate hydratase
     Rv1023 (eno)
Messenger RNA biogenesis [BR:mtu03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Rv1023 (eno)
Exosome [BR:mtu04147]
 Exosomal proteins
  Proteins found in most exosomes
   Rv1023 (eno)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Enolase_C Enolase_N MR_MLE_C MAAL_C
Motif
Other DBs
NCBI-GeneID: 886062
NCBI-ProteinID: NP_215539
TubercuList: Rv1023
UniProt: P9WNL1 I6XWV0
Position
1144564..1145853
Genome map
AA seq 429 aa AA seqDB search
MPIIEQVRAREILDSRGNPTVEVEVALIDGTFARAAVPSGASTGEHEAVELRDGGDRYGG
KGVQKAVQAVLDEIGPAVIGLNADDQRLVDQALVDLDGTPDKSRLGGNAILGVSLAVAKA
AADSAELPLFRYVGGPNAHILPVPMMNILNGGAHADTAVDIQEFMVAPIGAPSFVEALRW
GAEVYHALKSVLKKEGLSTGLGDEGGFAPDVAGTTAALDLISRAIESAGLRPGADVALAL
DAAATEFFTDGTGYVFEGTTRTADQMTEFYAGLLGAYPLVSIEDPLSEDDWDGWAALTAS
IGDRVQIVGDDIFVTNPERLEEGIERGVANALLVKVNQIGTLTETLDAVTLAHHGGYRTM
ISHRSGETEDTMIADLAVAIGSGQIKTGAPARSERVAKYNQLLRIEEALGDAARYAGDLA
FPRFACETK
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
gtgccgattatcgagcaggttagggcccgagagatcctcgattcccgcggcaacccgacg
gtggaggtcgaggtggcgcttatcgacgggacattcgcccgggccgcggtgccgtcgggc
gcctcgaccggggagcacgaggccgtcgagttgcgcgacggcggcgatcgctacggcggc
aaaggcgtgcaaaaagccgtgcaggctgttcttgatgagatcggcccggccgtcatcgga
ctcaacgccgacgaccagcgattggtcgaccaggcgctggtggacctagacggcaccccc
gacaagtcccggctgggcggcaacgcgatcttgggtgtctcgctcgctgttgccaaggcg
gcggcggattcggcggagctgccgttgttccgttatgtcggggggccaaacgcgcacatt
ctgccggtaccgatgatgaacatcctcaacggcggcgcacacgccgataccgctgtcgac
attcaagagttcatggtggcgccaattggcgcgcccagcttcgtcgaggcgttgcgctgg
ggcgctgaggtgtaccacgcgctcaagtcggtcctgaaaaaggaggggctgtccaccggc
ctgggcgacgaaggcggcttcgccccggatgtggccggcaccaccgcggcgttggacctg
atcagccgggccatcgagtcggcgggcttgcgacccggcgccgacgtggcgctggccctg
gacgcggcggccaccgagttcttcaccgacggcaccggctacgtcttcgagggcaccacc
cgtaccgcagaccagatgaccgagttctacgcgggcctgctcggcgcctacccgctggtg
tcgatcgaagacccactgtccgaagacgattgggacggctgggccgcgctgacggcctcg
atcggtgaccgggtgcaaatcgtcggcgacgacatctttgtcaccaatcccgagcggctc
gaggagggcatcgaacggggcgtggcaaatgcgttgctggtcaaggtgaaccagatcggg
acgttgaccgagacactcgacgcggtcacgctggctcaccacggcggataccgcacgatg
atcagtcaccgcagtggcgagacggaggacaccatgatcgccgacctcgcggtggccatc
ggcagcgggcagatcaagacgggcgcgcctgctcgcagtgagcgcgtcgcaaaatacaac
cagctgctgcggatcgaagaggcgcttggcgacgcggcccgctacgcgggcgacctggca
tttcctcggttcgcgtgcgagacgaaatag

DBGET integrated database retrieval system