KEGG   Mycobacterium tuberculosis H37Rv: Rv1077Help
Entry
Rv1077            CDS       T00015                                 

Gene name
cbs
Definition
(RefSeq) cystathionine beta-synthase
  KO
K01697  cystathionine beta-synthase [EC:4.2.1.22]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00260  Glycine, serine and threonine metabolism
mtu00270  Cysteine and methionine metabolism
mtu01100  Metabolic pathways
mtu01130  Biosynthesis of antibiotics
mtu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rv1077 (cbs)
   00270 Cysteine and methionine metabolism
    Rv1077 (cbs)
Enzymes [BR:mtu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.22  cystathionine beta-synthase
     Rv1077 (cbs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP CBS
Motif
Other DBs
NCBI-GeneID: 887108
NCBI-ProteinID: YP_177782
TubercuList: Rv1077
UniProt: P9WP51 I6XX03
Position
1201717..1203111
Genome map
AA seq 464 aa AA seqDB search
MRIAQHISELIGGTPLVRLNSVVPDGAGTVAAKVEYLNPGGSSKDRIAVKMIEAAEASGQ
LKPGGTIVEPTSGNTGVGLALVAQRRGYKCVFVCPDKVSEDKRNVLIAYGAEVVVCPTAV
PPHDPASYYSVSDRLVRDIDGAWKPDQYANPEGPASHYVTTGPEIWADTEGKVTHFVAGI
GTGGTITGAGRYLKEVSGGRVRIVGADPEGSVYSGGAGRPYLVEGVGEDFWPAAYDPSVP
DEIIAVSDSDSFDMTRRLAREEAMLVGGSCGMAVVAALKVAEEAGPDALIVVLLPDGGRG
YMSKIFNDAWMSSYGFLRSRLDGSTEQSTVGDVLRRKSGALPALVHTHPSETVRDAIGIL
REYGVSQMPVVGAEPPVMAGEVAGSVSERELLSAVFEGRAKLADAVSAHMSPPLRMIGAG
ELVSAAGKALRDWDALMVVEEGKPVGVITRYDLLGFLSEGAGRR
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgcggatcgcgcaacatatcagtgaactcattggtggtaccccactggttcggctgaac
tccgtggtacccgacggcgccggaaccgtggccgcaaaggtcgagtatctcaaccctggc
ggcagctccaaggatcggatcgcggtgaagatgatcgaagccgccgaggccagcggtcag
ctgaagccgggtggcaccatcgtcgaacccacgtccggcaataccggcgttggtctggcg
ttggtcgctcagcgccgcggctacaagtgcgtgttcgtctgcccggacaaggtcagtgag
gataaacgcaatgtgttgatcgcctacggcgccgaggtcgtggtgtgcccgacggcggtc
ccgccgcacgatccggccagctactacagtgtgtcggaccggttggtccgtgatatcgac
ggtgcctggaagcccgaccagtacgccaacccggagggaccggcaagccattatgtgacc
accggcccggaaatctgggccgataccgagggcaaggtcacccatttcgtggctggcatc
ggcaccggcggtaccatcaccggcgctggccggtacctcaaagaggtgtccgggggccga
gtacgcatcgtcggcgccgacccggagggatcggtctattcgggcggtgccggccgaccg
tatctggtcgagggggtcggcgaggatttctggccggcggcctatgacccgagcgtgccc
gacgagatcatcgcggtgtccgactccgactcgttcgacatgaccaggcggctggcccgc
gaagaggcgatgttggtcggcgggtcgtgcgggatggcggtggttgccgcgctcaaggtc
gccgaggaagccgggcccgacgcgttgatcgtcgtcctgttgcccgacggcggccggggc
tacatgtcgaaaatcttcaacgacgcgtggatgtcgtcctatgggttcctgcgcagccgc
cttgacgggtcgaccgagcaatccaccgtcggtgatgtgttgcgccgcaagtccggcgcg
ctgcccgccctggtgcacacccatccgtcggagaccgtgcgcgacgccatcgggattctt
cgcgagtacggggtgtcgcagatgccggtggtcggcgccgagccgccggtgatggccggc
gaggtcgccggtagcgtctcggaacgcgagctgctctcggccgtgttcgagggccgcgcc
aagttggccgacgccgtgtcggcacacatgagcccgccgctgcggatgataggcgccggt
gaattggtcagtgcggccggcaaggcgttgcgtgattgggatgcgttgatggtggtggag
gaaggcaagccggttggggtcattacccggtacgacttgttgggcttcttgtcggagggg
gcgggacggcggtag

DBGET integrated database retrieval system