KEGG   Mycobacterium tuberculosis H37Rv: Rv1079Help
Entry
Rv1079            CDS       T00015                                 

Gene name
metB
Definition
(RefSeq) cystathionine gamma-synthase
  KO
K01739  cystathionine gamma-synthase [EC:2.5.1.48]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00270  Cysteine and methionine metabolism
mtu00450  Selenocompound metabolism
mtu00920  Sulfur metabolism
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01130  Biosynthesis of antibiotics
mtu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    Rv1079 (metB)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Rv1079 (metB)
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Rv1079 (metB)
Enzymes [BR:mtu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.48  cystathionine gamma-synthase
     Rv1079 (metB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP DegT_DnrJ_EryC1 Met_gamma_lyase Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 887103
NCBI-ProteinID: NP_215595
TubercuList: Rv1079
UniProt: P9WGB7 I6Y9K1
Position
1204067..1205233
Genome map
AA seq 388 aa AA seqDB search
MSEDRTGHQGISGPATRAIHAGYRPDPATGAVNVPIYASSTFAQDGVGGLRGGFEYARTG
NPTRAALEASLAAVEEGAFARAFSSGMAATDCALRAMLRPGDHVVIPDDAYGGTFRLIDK
VFTRWDVQYTPVRLADLDAVGAAITPRTRLIWVETPTNPLLSIADITAIAELGTDRSAKV
LVDNTFASPALQQPLRLGADVVLHSTTKYIGGHSDVVGGALVTNDEELDEEFAFLQNGAG
AVPGPFDAYLTMRGLKTLVLRMQRHSENACAVAEFLADHPSVSSVLYPGLPSHPGHEIAA
RQMRGFGGMVSVRMRAGRRAAQDLCAKTRVFILAESLGGVESLIEHPSAMTHASTAGSQL
EVPDDLVRLSVGIEDIADLLGDLEQALG
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaagaccgcacgggacaccagggaatcagcggaccggccacccgcgccatccac
gctggctaccgcccggatccggcgaccggggcggtgaacgtgccgatctacgccagcagc
accttcgcccaagacggcgtcggcggtctgcgtggcggtttcgaatacgcacgcaccggc
aaccccacccgggccgcattggaggcctcgctggcggcagtcgaggagggtgctttcgcg
cgggcattcagttccgggatggccgcgaccgactgcgccctgcgggcgatgttacggccc
ggagaccacgtcgtcattcccgatgacgcctacggcggcacattccggttgatagacaag
gtgttcacccggtgggatgtccagtacacgccggtgcggcttgccgatctggatgcggtg
ggtgccgcgattactccgcgcacccggctgatttgggtggagacgcccaccaatccgcta
ctgtcgatcgccgatatcacggccattgccgagctgggcacagacagatcggcaaaagta
ttggtggacaatacctttgcctcacccgcgttgcagcagccgttgcggctgggcgccgat
gtggtgttgcactcgactaccaagtacatcggcggccattccgacgtggtgggaggtgcg
ctggtcaccaacgacgaagagctggacgaggagttcgctttcttgcagaacggcgccggc
gcggtgcccggaccattcgacgcctacctgaccatgcgcggcctgaagaccttggtgctg
cggatgcagcggcacagtgaaaatgcctgtgcggtagcggaattcctcgctgatcatccg
tcggtgagttctgtgttgtatccgggtttgcccagtcatcccgggcatgagattgccgcg
cgacagatgcgcggcttcggcggcatggtttcggtgcggatgcgggccggtcggcgtgcg
gcgcaggacctgtgtgccaagacccgcgtcttcatcctggccgagtcgctgggtggggtg
gagtcgctgatcgaacatcccagcgccatgacccatgcgtcgacggccggttcgcaattg
gaggtgcccgacgatctggtgcggctttcggtcggtatcgaagacattgccgacctgctc
ggcgatctcgaacaggccctgggttaa

DBGET integrated database retrieval system