KEGG   Mycobacterium tuberculosis H37Rv: Rv1086Help
Entry
Rv1086            CDS       T00015                                 

Definition
(RefSeq) (2Z,6E)-farnesyl diphosphate synthase
  KO
K12503  short-chain Z-isoprenyl diphosphate synthase [EC:2.5.1.68]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00900  Terpenoid backbone biosynthesis
mtu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Rv1086
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:mtu01006]
    Rv1086
Enzymes [BR:mtu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.68  (2Z,6E)-farnesyl diphosphate synthase
     Rv1086
Prenyltransferases [BR:mtu01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   Rv1086
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Prenyltransf
Motif
Other DBs
NCBI-GeneID: 887097
NCBI-ProteinID: NP_215602
TubercuList: Rv1086
UniProt: P9WFF5 I6Y5K0
Structure
PDB: 

Position
1210595..1211383
Genome map
AA seq 262 aa AA seqDB search
MEIIPPRLKEPLYRLYELRLRQGLAASKSDLPRHIAVLCDGNRRWARSAGYDDVSYGYRM
GAAKIAEMLRWCHEAGIELATVYLLSTENLQRDPDELAALIEIITDVVEEICAPANHWSV
RTVGDLGLIGEEPARRLRGAVESTPEVASFHVNVAVGYGGRREIVDAVRALLSKELANGA
TAEELVDAVTVEGISENLYTSGQPDPDLVIRTSGEQRLSGFLLWQSAYSEMWFTEAHWPA
FRHVDFLRALRDYSARHRSYGR
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
gtggagatcatcccgccgcggctcaaagagccgttgtaccggctctacgagctgcgcctg
cggcagggcttggccgcctcgaaatccgacctgccccggcacatagccgtgctgtgcgac
ggcaaccggcgatgggcgcgcagcgcgggctacgacgacgtcagctacggctaccggatg
ggtgcggccaagatcgccgaaatgctgcggtggtgccacgaagccggcatcgaactggcc
accgtctatctgctgtccaccgaaaacctgcagcgcgatcccgacgagcttgcagcactc
atcgagatcatcaccgatgtcgtggaagagatctgcgcaccggccaaccactggagtgtg
cggacggtcggggatctggggttgatcggcgaggaaccggcccggcggctgcgcggtgcg
gtggaatccaccccggaggtggcctcgtttcatgtcaacgttgctgttggctacggcggg
cgccgcgagatcgtcgacgctgtgcgcgcgttgttgagcaaggaactcgccaacggggcc
accgcggaggaactcgtcgacgcggtgaccgtcgagggtatctcggaaaacctgtacacc
tcaggccaacccgaccccgatttggtgatacgcacctccggcgagcaacgcttgtccggg
ttcttgctgtggcaaagcgcctactcggagatgtggttcaccgaggcgcactggccggcg
tttcgccacgtcgattttctacgcgcgctgcgtgactacagtgcgaggcatcgcagctac
ggcaggtga

DBGET integrated database retrieval system