KEGG   Mycobacterium tuberculosis H37Rv: Rv1093Help
Entry
Rv1093            CDS       T00015                                 

Gene name
glyA1
Definition
(RefSeq) serine hydroxymethyltransferase
  KO
K00600  glycine hydroxymethyltransferase [EC:2.1.2.1]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00260  Glycine, serine and threonine metabolism
mtu00460  Cyanoamino acid metabolism
mtu00630  Glyoxylate and dicarboxylate metabolism
mtu00670  One carbon pool by folate
mtu00680  Methane metabolism
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01120  Microbial metabolism in diverse environments
mtu01130  Biosynthesis of antibiotics
mtu01200  Carbon metabolism
mtu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Rv1093 (glyA1)
  09102 Energy metabolism
   00680 Methane metabolism
    Rv1093 (glyA1)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rv1093 (glyA1)
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    Rv1093 (glyA1)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Rv1093 (glyA1)
Enzymes [BR:mtu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.1  glycine hydroxymethyltransferase
     Rv1093 (glyA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SHMT DegT_DnrJ_EryC1 SelA
Motif
Other DBs
NCBI-GeneID: 885338
NCBI-ProteinID: YP_177787
TubercuList: Rv1093
UniProt: P9WGI9 I6X0A7
Structure
PDB: 

Position
1220574..1221854
Genome map
AA seq 426 aa AA seqDB search
MSAPLAEVDPDIAELLAKELGRQRDTLEMIASENFVPRAVLQAQGSVLTNKYAEGLPGRR
YYGGCEHVDVVENLARDRAKALFGAEFANVQPHSGAQANAAVLHALMSPGERLLGLDLAN
GGHLTHGMRLNFSGKLYENGFYGVDPATHLIDMDAVRATALEFRPKVIIAGWSAYPRVLD
FAAFRSIADEVGAKLLVDMAHFAGLVAAGLHPSPVPHADVVSTTVHKTLGGGRSGLIVGK
QQYAKAINSAVFPGQQGGPLMHVIAGKAVALKIAATPEFADRQRRTLSGARIIADRLMAP
DVAKAGVSVVSGGTDVHLVLVDLRDSPLDGQAAEDLLHEVGITVNRNAVPNDPRPPMVTS
GLRIGTPALATRGFGDTEFTEVADIIATALATGSSVDVSALKDRATRLARAFPLYDGLEE
WSLVGR
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccccgctcgctgaggttgaccccgatatcgccgagttgctggccaaggagctt
ggtcggcaacgagacaccctggagatgatcgcctcggagaacttcgtaccgcgcgctgtg
ctgcaggcccagggcagtgtgctgaccaacaagtacgccgagggactgcccgggcggcgc
tactacggcggttgtgagcacgtcgacgtggtggaaaacctcgcccgcgaccgagccaag
gcgttgttcggtgccgaattcgccaatgtgcaaccgcattcgggcgctcaggccaacgcc
gcggtgctgcatgcgctgatgtcacccggcgagcggctgttgggtctggacctggccaac
ggtggtcacctgacccatggcatgcggctgaacttctccggcaagctctacgagaatggc
ttctacggcgtcgacccggcgacacatctgatcgacatggatgcggtgcgggccaccgca
ctcgaattccgcccgaaggtgatcatcgccggctggtcggcctacccgcgggtgctcgac
ttcgcggcgttccggtcgatcgccgacgaggtcggggccaagttgctcgtggacatggcg
catttcgcgggtctggtcgccgcggggttgcacccgtcgccggtgccgcacgcggatgtg
gtgtccaccaccgtgcacaagacgctcggcggcggccgctccggcctgatcgtcggtaag
cagcagtacgccaaggcgatcaactcggcggtgtttcccgggcagcagggcggtccgctc
atgcacgtcattgccggcaaggcggtcgcgttgaagatcgccgccacacccgaatttgcc
gaccggcagcggcgcacgctgtccggggcccggatcattgccgatcgactgatggctccc
gatgtcgccaaggccggtgtgtcggtggtcagcggcggcaccgacgtccacctggtgctg
gtcgatctgcgtgattccccactggatggccaggccgccgaggacctgctgcacgaggtc
ggcatcacggtcaaccgcaacgccgtccccaatgatccccgaccgccgatggtgacctcg
ggcctgcggataggcacgcccgcgctggcgacccgcggcttcggcgacaccgagttcacc
gaggtcgccgacattattgcgaccgcgctggcgaccggcagttccgttgatgtgtcggcg
cttaaggatcgggcgacccggctggccagggcgtttccgctctacgacgggctcgaggag
tggagtctggtcggccgctga

DBGET integrated database retrieval system