KEGG   Mycobacterium tuberculosis H37Rv: Rv1122Help
Entry
Rv1122            CDS       T00015                                 

Gene name
gnd2
Definition
(RefSeq) 6-phosphogluconate dehydrogenase (decarboxylating)
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00030  Pentose phosphate pathway
mtu00480  Glutathione metabolism
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01120  Microbial metabolism in diverse environments
mtu01130  Biosynthesis of antibiotics
mtu01200  Carbon metabolism
Module
mtu_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
mtu_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Rv1122 (gnd2)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Rv1122 (gnd2)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     Rv1122 (gnd2)
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     Rv1122 (gnd2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_2 6PGD F420_oxidored 2-Hacid_dh_C TrkA_N 3HCDH_N GFO_IDH_MocA UDPG_MGDP_dh_N Shikimate_DH Sacchrp_dh_NADP NAD_binding_11 Rossmann-like PDH
Motif
Other DBs
NCBI-GeneID: 885820
NCBI-ProteinID: NP_215638
TubercuList: Rv1122
UniProt: O06574 A0A089QKV8
Position
1245129..1246151
Genome map
AA seq 340 aa AA seqDB search
MQLGMIGLGRMGANIVRRLAKGGHDCVVYDHDPDAVKAMAGEDRTTGVASLRELSQRLSA
PRVVWVMVPAGNITTAVIEELANTLEAGDIVIDGGNTYYRDDLRHEKLLFKKGIHLLDCG
TSGGVWGRERGYCLMIGGDGDAFARAEPIFATVAPGVAAAPRTPGRDGEVAPSEQGYLHC
GPCGSGHFVKMVHNGIEYGMMASLAEGLNILRNADVGTRVQHGDAETAPLPNPECYQYDF
DIPEVAEVWRRGSVIGSWLLDLTAIALRESPDLAEFSGRVSDSGEGRWTAIAAIDEGVPA
PVLTTALQSRFASRDLDDFANKALSAMRKQFGGHAEKPAN
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgcaactaggaatgatcggtctgggccggatgggtgcgaatatcgtccgccgcttggcc
aaaggtggacacgactgcgtggtctacgaccacgaccccgacgcggtcaaggcgatggcc
ggggaggaccggaccaccggggtggcctcgttgcgtgagttgtctcagcggctctccgcc
ccgcgagttgtctgggtgatggtgcccgcggggaacatcaccaccgcggtgatcgaagag
ctggccaacacgctcgaggccggcgacattgtgatcgacggtggcaacacctattatcgc
gacgatctgcggcacgaaaagctgttgttcaagaagggaattcacctactcgactgtggc
accagcggcggtgtgtggggtcgggaacgtggctactgcctgatgatcggcggggatggc
gacgcgttcgcgcgcgcggagccgatcttcgccaccgtcgcgccgggggtggcggccgcc
ccgcgcaccccgggccgagacggtgaggtcgcgccatcggaacaaggctatttgcattgt
gggccttgcggttcgggtcacttcgtgaagatggtccacaacggcatcgaatacgggatg
atggcctccttggcggagggattgaacatcctgcgcaatgccgacgtcggcacccgcgtg
caacacggtgacgccgaaaccgcgccgctgccgaatcccgagtgctaccagtacgacttc
gacatcccggaggtcgccgaggtatggcggcggggcagcgtgatcggctcctggctgctg
gatttgaccgcgatcgcgctgcgcgaatcacctgacctagcggaattctccggacgggtc
tccgactctggcgagggccggtggaccgccatcgcggcgatcgacgagggcgtgcccgcg
ccggtgctgaccaccgcgctgcagtcccgcttcgcctcgcgtgacctcgacgacttcgcc
aacaaggcgctgtcggcgatgcgcaagcagttcggcggacacgccgagaaaccggctaac
taa

DBGET integrated database retrieval system