KEGG   Mycobacterium tuberculosis H37Rv: Rv1131Help
Entry
Rv1131            CDS       T00015                                 

Gene name
prpC
Definition
(RefSeq) methylcitrate synthase PrpC
  KO
K01647  citrate synthase [EC:2.3.3.1]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00020  Citrate cycle (TCA cycle)
mtu00630  Glyoxylate and dicarboxylate metabolism
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01120  Microbial metabolism in diverse environments
mtu01130  Biosynthesis of antibiotics
mtu01200  Carbon metabolism
mtu01210  2-Oxocarboxylic acid metabolism
mtu01230  Biosynthesis of amino acids
Module
mtu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mtu_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
mtu_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Rv1131 (prpC)
   00630 Glyoxylate and dicarboxylate metabolism
    Rv1131 (prpC)
Enzymes [BR:mtu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.1  citrate (Si)-synthase
     Rv1131 (prpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Citrate_synt
Motif
Other DBs
NCBI-GeneID: 888949
NCBI-ProteinID: NP_215647
TubercuList: Rv1131
UniProt: I6Y9Q3
Structure
PDB: 

Position
1256132..1257313
Genome map
AA seq 393 aa AA seqDB search
MTGPLAAARSVAATKSMTAPTVDERPDIKKGLAGVVVDTTAISKVVPQTNSLTYRGYPVQ
DLAARCSFEQVAFLLWRGELPTDAELALFSQRERASRRVDRSMLSLLAKLPDNCHPMDVV
RTAISYLGAEDPDEDDAAANRAKAMRMMAVLPTIVAIDMRRRRGLPPIAPHSGLGYAQNF
LHMCFGEVPETAVVSAFEQSMILYAEHGFNASTFAARVVTSTQSDIYSAVTGAIGALKGR
LHGGANEAVMHDMIEIGDPANAREWLRAKLARKEKIMGFGHRVYRHGDSRVPTMKRALER
VGTVRDGQRWLDIYQVLAAEMASATGILPNLDFPTGPAYYLMGFDIASFTPIFVMSRITG
WTAHIMEQATANALIRPLSAYCGHEQRVLPGTF
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaccgggccgctcgcggcggccaggtccgtcgctgccacgaaatcgatgaccgcgccc
accgttgatgagcggcccgacatcaaaaagggcctcgccggcgtggtggtggacaccacc
gccatctccaaggtggtgccgcagaccaattcgttgacctaccggggatatccggtccag
gatctggcagcccgctgcagtttcgagcaggtcgccttcctgctgtggcgtggtgagttg
cccaccgatgccgagctggcgttgttcagccagcgcgaacgagccagccgtcgggtggac
cgctcgatgctgtcattgctggccaagctgccggacaactgccacccgatggacgtggtg
cgcaccgcgatcagctatctcggtgccgaggacccggacgaggacgacgccgcggccaac
cgggccaaggcgatgcgcatgatggcggtgttgccgacgatcgtggcgatcgacatgcgg
cgccgacgcgggttgcccccgatcgcaccgcacagcgggctcggttatgcgcagaacttc
ctgcacatgtgcttcggggaggtacccgaaaccgccgtcgtgtcggcgttcgagcagtcg
atgatcctctacgccgagcacggattcaacgcgtcgacgttcgccgcccgggtggtgacc
tcgacccaatccgacatctacagcgcggtgaccggcgcgatcggcgccctcaaggggcgg
ctacacggcggcgccaacgaagccgtcatgcacgacatgatcgagatcggcgatccggcc
aacgcgcgggagtggttgcgcgccaagctcgcccgcaaggaaaagatcatgggcttcggg
catcgggtgtaccggcacggcgactcccgggtgccgaccatgaaacgggcgctggagcgc
gtggggaccgttcgcgacggccagcgatggctggacatctaccaggtgttagcggccgag
atggcgtcggccaccgggatcttgcccaacctcgattttccgaccgggcccgcgtactac
ctgatgggattcgacatcgccagcttcaccccgatcttcgtgatgagtaggatcaccggc
tggaccgcacacatcatggaacaggccacggccaacgcgctgatccggccgctgagcgca
tattgcgggcacgagcagcgggtgttaccgggcaccttctag

DBGET integrated database retrieval system