KEGG   Mycobacterium tuberculosis H37Rv: Rv1133cHelp
Entry
Rv1133c           CDS       T00015                                 

Gene name
metE
Definition
(RefSeq) 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase
  KO
K00549  5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase [EC:2.1.1.14]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00270  Cysteine and methionine metabolism
mtu00450  Selenocompound metabolism
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Rv1133c (metE)
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Rv1133c (metE)
Enzymes [BR:mtu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.14  5-methyltetrahydropteroyltriglutamate---homocysteine S-methyltransferase
     Rv1133c (metE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Meth_synt_2 Meth_synt_1 SHOCT
Motif
Other DBs
NCBI-GeneID: 888947
NCBI-ProteinID: NP_215649
TubercuList: Rv1133c
UniProt: P9WK07 I6Y5P6
Position
complement(1259067..1261346)
Genome map
AA seq 759 aa AA seqDB search
MTQPVRRQPFTATITGSPRIGPRRELKRATEGYWAGRTSRSELEAVAATLRRDTWSALAA
AGLDSVPVNTFSYYDQMLDTAVLLGALPPRVSPVSDGLDRYFAAARGTDQIAPLEMTKWF
DTNYHYLVPEIGPSTTFTLHPGKVLAELKEALGQGIPARPVIIGPITFLLLSKAVDGAGA
PIERLEELVPVYSELLSLLADGGAQWVQFDEPALVTDLSPDAPALAEAVYTALCSVSNRP
AIYVATYFGDPGAALPALARTPVEAIGVDLVAGADTSVAGVPELAGKTLVAGVVDGRNVW
RTDLEAALGTLATLLGSAATVAVSTSCSTLHVPYSLEPETDLDDALRSWLAFGAEKVREV
VVLARALRDGHDAVADEIASSRAAIASRKRDPRLHNGQIRARIEAIVASGAHRGNAAQRR
ASQDARLHLPPLPTTTIGSYPQTSAIRVARAALRAGEIDEAEYVRRMRQEITEVIALQER
LGLDVLVHGEPERNDMVQYFAEQLAGFFATQNGWVQSYGSRCVRPPILYGDVSRPRAMTV
EWITYAQSLTDKPVKGMLTGPVTILAWSFVRDDQPLADTANQVALAIRDETVDLQSAGIA
VIQVDEPALRELLPLRRADQAEYLRWAVGAFRLATSGVSDATQIHTHLCYSEFGEVIGAI
ADLDADVTSIEAARSHMEVLDDLNAIGFANGVGPGVYDIHSPRVPSAEEMADSLRAALRA
VPAERLWVNPDCGLKTRNVDEVTASLHNMVAAAREVRAG
NT seq 2280 nt NT seq  +upstreamnt  +downstreamnt
gtgacccagcctgtacgtcgtcaaccctttaccgcaaccatcaccggctccccgcgcatc
ggcccgcgccgcgaactcaagcgcgccaccgaaggctactgggccggacgtaccagccga
tccgagctggaggccgtcgccgccacgttacgccgcgacacctggtcggccctggccgcg
gccggtctggactcggtgccggtgaacaccttctcctactacgaccaaatgctcgatacc
gcggtgctgctcggcgcgctgccgccccgagtgagcccggtttccgacgggctggaccgc
tatttcgccgcggcgcggggcaccgaccagatcgcgccgctggagatgacgaagtggttc
gacaccaactaccactacctggtacccgagatcgggccgtcgaccacgttcacgctgcac
cccggcaaggtgctcgccgaactcaaagaggcgttagggcaaggcattcccgcacgtccg
gtgatcatcgggccgatcaccttcctgctgctgagcaaggccgtcgacggcgcgggggcg
ccgatcgaacgcctcgaagagttggttccggtctattcggagctgctgtcgctgcttgcc
gacggcggcgcccagtgggtgcagttcgacgagccggcgctggtgaccgacctctccccc
gacgcgcccgccctggctgaagcggtgtacaccgcgctgtgctcggtgagcaaccggcct
gcgatctatgtcgccacctacttcggggacccgggcgcggccctaccggcgctggctcgc
accccggtcgaagccatcggcgtcgacctggtggccggtgccgacacctcggtggccggg
gtacccgagctggccggcaagacgctggtggccggggtcgtcgacgggcgcaacgtctgg
cgcaccgacctggaggcggcgttgggcacgttggcgaccctgctgggttcggcggctacc
gtggccgtctcgacgtcgtgctcgacactgcacgtgccgtactcgctggaaccggaaacc
gacctggatgacgcgttgcggagctggctggcgttcggtgccgaaaaggtgcgcgaagtc
gtcgttctcgcgcgtgccctgcgcgacggacacgacgcggtcgccgacgagatcgcgtcg
tcccgcgccgccatcgcgtcccgcaagcgcgacccgcggttacacaatgggcaaatccgg
gcgcgcatcgaggcgatcgtcgcgtccggagcccaccgcggcaatgccgcccagcgccgc
gccagccaagacgcgcgactgcacctgccgccgctgccgaccacgacgatcggctcctac
ccgcagacctcggcgatccgcgttgcgcgtgcggcgctgcgggccggtgagatcgacgag
gccgagtacgtgcgccggatgcggcaagagatcaccgaggtgatcgcgctacaggagcgg
ctcgggctcgacgtgctggtgcacggcgaaccggagcgcaacgacatggtgcagtacttc
gccgagcaattggcgggtttcttcgctacccagaacggctgggtgcagtcctacggcagc
cgctgtgtgcgtccgccgatcctgtacggcgacgtgtcccggccgcgggcgatgacggtc
gagtggatcacctacgcgcagtcgctgaccgacaaaccggtgaagggcatgttgaccggg
ccggtgacgattctggcgtggtcgttcgtgcgtgacgaccagccgttggccgataccgcc
aaccaggtggcgctggcgattcgcgacgagaccgtggatttgcagtccgccggcatcgcg
gtcatccaggtcgacgagcctgcgctgcgtgaactgctgccgctgcgtcgcgccgaccag
gccgagtacttgcgttgggcggtaggggctttccggttggccacctccggcgtctcggac
gccacccagatccacacgcatctgtgctactcggagttcggcgaggtgatcggcgcgatc
gccgatctggacgcggacgtcacgtccatcgaggcggcccggtcacacatggaggtgctc
gacgacctgaacgcgatcggcttcgccaacggtgtgggcccgggcgtctatgacattcac
tcgccacgggtgccctccgctgaggagatggccgactcgttgcgggccgcgttgcgcgcg
gtgccggccgagcggctgtgggtcaaccccgactgcggactgaagacccgcaatgtcgac
gaggtgaccgcgtcgctgcacaacatggtcgccgccgcccgggaggtgcgcgcgggctag

DBGET integrated database retrieval system