KEGG   Mycobacterium tuberculosis H37Rv: Rv1144Help
Entry
Rv1144            CDS       T00015                                 

Definition
(RefSeq) oxidoreductase
Organism
mtu  Mycobacterium tuberculosis H37Rv
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 KR Epimerase 3Beta_HSD NAD_binding_10 RmlD_sub_bind
Motif
Other DBs
NCBI-GeneID: 885932
NCBI-ProteinID: NP_215660
TubercuList: Rv1144
UniProt: P9WGQ7 I6Y9R7
Position
1271156..1271908
Genome map
AA seq 250 aa AA seqDB search
MKTKDAVAVVTGGASGLGLATTKRLLDAGAQVVVVDLRGDDVVGGLGDRARFAQADVTDE
AAVSNALELADSLGPVRVVVNCAGTGNAIRVLSRDGVFPLAAFRKIVDINLVGTFNVLRL
GAERIAKTEPIGEERGVIINTASVAAFDGQIGQAAYSASKGGVVGMTLPIARDLASKLIR
VVTIAPGLFDTPLLASLPAEAKASLGQQVPHPSRLGNPDEYGALVLHIIENPMLNGEVIR
LDGAIRMAPR
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccaaagacgccgtagccgttgtcaccggtggcgcctcaggcctgggtctggcc
accaccaagcggctattggacgctggggcacaggtggtcgtcgtggacctccgcggcgac
gacgtggttggcgggctcggcgatcgcgcgcgttttgcgcaagccgacgtcaccgacgaa
gccgccgtcagcaacgcgctagagctggcggattcgctcggcccggtgcgggtcgtcgtc
aactgcgccggcaccggcaacgcgattcgcgtactgagtcgcgacggcgtgttcccgctg
gccgcgttccgcaagatcgtggacatcaacctagtcggcaccttcaacgtgctgcgactg
ggcgccgagcggatcgccaagaccgaaccgattggggaagagcgcggcgtcatcattaac
accgcctcggtggcggcattcgacggtcagatcggccaggccgcctactcggcgtccaag
ggcggcgtagttggcatgaccctgccgatcgcccgcgatctggccagcaagctgatccgg
gtggtcaccattgcgccgggtctgttcgacaccccgctgctggcttcattgccggcggag
gccaaggcctcactgggccaacaggtgccgcatccctcgcggctgggcaaccccgacgag
tacggggcgctagttctgcacatcatcgaaaacccgatgcttaacggcgaggtcatccgt
ctggacggcgccatccgcatggcgccgcgctaa

DBGET integrated database retrieval system