KEGG   Mycobacterium tuberculosis H37Rv: Rv1201cHelp
Entry
Rv1201c           CDS       T00015                                 

Gene name
dapD
Definition
(RefSeq) 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
  KO
K00674  2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase [EC:2.3.1.117]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00300  Lysine biosynthesis
mtu01100  Metabolic pathways
mtu01120  Microbial metabolism in diverse environments
mtu01230  Biosynthesis of amino acids
Module
mtu_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    Rv1201c (dapD)
Enzymes [BR:mtu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.117  2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
     Rv1201c (dapD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: THDPS_M Hexapep_2 Hexapep
Motif
Other DBs
NCBI-GeneID: 886088
NCBI-ProteinID: NP_215717
TubercuList: Rv1201c
UniProt: P9WP21
Structure
PDB: 

Position
complement(1344216..1345169)
Genome map
AA seq 317 aa AA seqDB search
MSTVTGAAGIGLATLAADGSVLDTWFPAPELTESGTSATSRLAVSDVPVELAALIGRDDD
RRTETIAVRTVIGSLDDVAADPYDAYLRLHLLSHRLVAPHGLNAGGLFGVLTNVVWTNHG
PCAIDGFEAVRARLRRRGPVTVYGVDKFPRMVDYVVPTGVRIADADRVRLGAHLAPGTTV
MHEGFVNYNAGTLGASMVEGRISAGVVVGDGSDVGGGASIMGTLSGGGTHVISIGKRCLL
GANSGLGISLGDDCVVEAGLYVTAGTRVTMPDSNSVKARELSGSSNLLFRRNSVSGAVEV
LARDGQGIALNEDLHAN
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgaccgtgactggagcagcaggcatcggcctggctaccctcgccgctgacggatcg
gtcctcgacacctggtttcccgcgccggaactgaccgaatcgggcaccagcgcgacgtca
cgactggcggtgtccgacgttcctgtcgagctggccgcgctgatcggccgcgatgacgac
cgccgcaccgagaccatcgcggtccgtacggtcatcggctcgctcgacgatgtcgccgct
gacccatacgatgcttacctgcggcttcacctcttgtcgcaccgcctggtggcgccccat
gggttgaacgccggcggcttgtttggggtgctgaccaatgtggtgtggaccaatcacgga
ccctgcgccatagacggtttcgaggcggtgcgggcgcggctgcgccgccgcggaccggtg
actgtgtatggcgtcgacaagtttccccggatggtcgactacgtcgtgcccaccggcgta
cgtatcgccgatgccgaccgcgtgcggttgggcgctcacctggcgccgggcaccaccgtg
atgcatgagggcttcgtcaactacaacgccggcaccctgggcgcctcgatggtggaaggc
cgcatctcggcgggtgtggtggtgggcgacggctccgatgtcggcggcggagcgtcgatc
atgggcacgctgtctggcggtggaacacacgtcatttcgatcggcaagcgttgtctgctc
ggcgccaactccggtctgggcatctcactgggcgacgactgcgtggtggaggccgggctg
tacgtgaccgccggcacgagggtcaccatgcccgacagcaattcggtcaaggcgcgtgag
ctctccgggagcagcaacctgctgtttcgccgcaattccgtcagcggggcggtcgaagtg
ctggcccgcgacggtcagggcattgccctcaacgaggacctgcacgccaactag

DBGET integrated database retrieval system