KEGG   Mycobacterium tuberculosis H37Rv: Rv1202Help
Entry
Rv1202            CDS       T00015                                 

Gene name
dapE
Definition
(RefSeq) succinyl-diaminopimelate desuccinylase DapE
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00300  Lysine biosynthesis
mtu01100  Metabolic pathways
mtu01120  Microbial metabolism in diverse environments
mtu01230  Biosynthesis of amino acids
Module
mtu_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    Rv1202 (dapE)
Enzymes [BR:mtu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Rv1202 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 Cyclase
Motif
Other DBs
NCBI-GeneID: 887386
NCBI-ProteinID: YP_177796
TubercuList: Rv1202
UniProt: P9WHS9 I6X0L6
Position
1345260..1346324
Genome map
AA seq 354 aa AA seqDB search
MLDLRGDPIELTAALIDIPSESRKEARIADEVEAALRAQASGFEIIRNGNAVLARTKLNR
SSRVLLAGHLDTVPVAGNLPSRRENDQLHGCGAADMKSGDAVFLHLAATLAEPTHDLTLV
FYDCEEIDSAANGLGRIQRELPDWLSADVAILGEPTAGCIEAGCQGTLRVVLSVTGTRAH
SARSWLGDNAIHKLGAVLDRLAVYRARSVDIDGCTYREGLSAVRVAGGVAGNVIPDAASV
TINYRFAPDRSVAAALQHVHDVFDGLDVQIEQTDAAAGALPGLSEPAAKALVEAAGGQVR
AKYGWTDVSRFAALGIPAVNYGPGDPNLAHCRDERVPVGNITAAVDLLRRYLGG
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
gtgctggatttgcgcggggacccgatcgaattgaccgcggcgctgattgacatccccagc
gagtcgaggaaggaggcacgcatcgccgacgaggtggaagcggcgttgcgcgctcaggca
tcggggttcgagatcatccgcaacggcaacgcggtgctggcgcgtacaaagctgaaccgg
tcctcgcgggtgctgttggccggacacctggacaccgtgccagtggccggcaacctgcct
agccgccgcgagaacgaccagctgcacggctgcggcgcagccgacatgaaatccggcgac
gcggtcttccttcatctggccgctacactggccgaaccgacgcacgatctaacactggtg
ttctacgactgcgaggaaatcgattcggcggcaaacggtttaggccgcatccagcgcgag
ctgccggactggctatccgcggatgtagccatcttgggtgagcccaccgccggctgcatc
gaggctggttgccagggcacgttgcgtgtcgtcctcagcgtgaccggaactcgcgcgcat
tcagcgcgttcgtggttgggtgacaacgcaatccacaagttgggtgctgtgctggaccgg
ttggccgtctaccgggcacgcagcgtcgacatcgacggttgcacctatcgggagggcctc
tcggcggtgcgcgtagcaggcggcgtcgccggcaacgtgatccctgacgcggcctcggtc
acgatcaactaccgctttgcccccgaccggtcggtggccgcggcattgcaacatgtccat
gacgtgttcgacgggctcgacgtgcagatcgagcagacggacgccgcggccggtgcgctg
cctggcctgtccgagcccgcggccaaggcgctggtcgaggccgccggcgggcaggtccgg
gccaagtatggctggactgatgtgtcgcgctttgccgctttgggcataccggcggtcaat
tacggcccgggtgatcccaacctggcgcactgccgcgacgaacgggtgcccgtcggcaac
atcaccgcggccgtggacttgctgcgccgatacctgggtggctag

DBGET integrated database retrieval system