KEGG   Mycobacterium tuberculosis H37Rv: Rv1257cHelp
Entry
Rv1257c           CDS       T00015                                 

Definition
(RefSeq) oxidoreductase
  KO
K00104  glycolate oxidase [EC:1.1.3.15]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00630  Glyoxylate and dicarboxylate metabolism
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01120  Microbial metabolism in diverse environments
mtu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Rv1257c
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.15  (S)-2-hydroxy-acid oxidase
     Rv1257c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD-oxidase_C FAD_binding_4 TORC_C
Motif
Other DBs
NCBI-GeneID: 887063
NCBI-ProteinID: NP_215773
TubercuList: Rv1257c
UniProt: A0A089QK33 Q11061
Position
complement(1404717..1406084)
Genome map
AA seq 455 aa AA seqDB search
MNTDVLAGLMAELPEGMVVTDPAVTDGYRQDRAFDPSAGKPLAIIRPRRTEEVQTVLRWA
SANQVPVVTRGAGSGLSGGATALDGGIVLSTEKMRDITVDPVTRTAVCQPGLYNAEVKEA
AAEHGLWYPPDPSSFEICSIGGNIATNAGGLCCVKYGVTGDYVLGMQVVLANGTAVRLGG
PRLKDVAGLSLTKLFVGSEGTLGVITEVTLRLLPAQNASSIVVASFGSVQAAVDAVLGVT
GRLRPAMLEFMDSVAINAVEDTLRMDLDRDAAAMLVAGSDERGRAATEDAAVMAAVFAEN
GAIDVFSTDDPDEGEAFIAARRFAIPAVESKGALLLEDVGVPLPALGELVTGIARIAEER
NLMISVIAHAGDGNTHPLLVYDPADAAMLERAHLAYGEIMDLAVGLGGTITGEHGVGRLK
RPWLAGYLGPDVLALNQRIKQALDPQGILNPGSAI
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
gtgaataccgatgtgctggctggcctgatggccgagctgcccgaggggatggtggtcacc
gaccccgccgtcaccgacggctaccggcaagaccgggcctttgacccttcggccggcaaa
ccgctggcaatcatccggccacggcgcaccgaagaggtgcagacggtgctgcgttgggcc
agtgcgaaccaggtgcccgtggtgacccgaggagccggtagcggcctttcgggcggggcg
accgccctggatggcgggatcgtgctgtccaccgaaaagatgcgcgacatcaccgtcgac
ccggtcacccgcaccgcagtgtgccagcccggcctgtacaacgccgaggtgaaggaggcc
gccgccgaacacggcctgtggtatcccccggatccgtcgtcgttcgagatctgcagcatc
ggcggcaacatcgccaccaacgccggcgggctgtgctgcgtgaagtacggcgtcacaggc
gactacgtactgggcatgcaggttgtgctggccaacggcaccgcggtccggctgggcggc
ccacggctcaaggacgtcgccgggctttccctgaccaaactgttcgtcggcagcgaaggc
acgctgggcgtcatcacggaggtgacgttgcgactgctgcccgcacagaatgcatcgagc
atcgtggtggccagcttcggctcggtgcaggcggcggtcgatgcggtgctcggggttacc
ggccgacttcgccccgcgatgctggagttcatggattcggtggcgatcaacgccgtcgag
gacaccttgcggatggacctggaccgcgatgcggcggccatgctggtggctggttctgat
gaacgtggccgcgcggccaccgaagacgccgccgtgatggccgccgtgttcgccgaaaac
ggtgcgatagacgtgttttcgaccgacgacccggatgagggcgaggcgttcattgcggcc
cggcggttcgccattccggcggtcgagagcaagggggcgttgctgctcgaggacgtcggg
gtaccgctgcccgcactgggcgaactggtcaccgggattgcgcgcatcgccgaggagcgg
aatctgatgatctcggtgatcgcccacgccggggacggcaatacccacccgttgctggtg
tacgaccccgcagatgccgcgatgctagagcgcgcccacctcgcgtacggcgaaatcatg
gacctggccgtcggcctgggcggcacgatcaccggcgaacacggcgtgggccggttgaaa
cggccgtggttggccggctatctcgggcccgacgtcctggccctcaaccagcgcatcaag
caagcgctggacccccagggcatcctcaatcccggctcggcgatctga

DBGET integrated database retrieval system