KEGG   Mycobacterium tuberculosis H37Rv: Rv1273cHelp
Entry
Rv1273c           CDS       T00015                                 

Definition
(RefSeq) drug ABC transporter ATP-binding protein
  KO
K06147  ATP-binding cassette, subfamily B, bacterial
Organism
mtu  Mycobacterium tuberculosis H37Rv
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mtu02000]
    Rv1273c
Transporters [BR:mtu02000]
 ABC Transporters, Eukaryotic Type
  ABCB (MDR/TAP) subfamily
   ABCB-BAC subgroup
    Rv1273c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_membrane ABC_tran SMC_N DUF87 Zeta_toxin AAA_29 AAA_23 RsgA_GTPase cobW FtsK_SpoIIIE MMR_HSR1 AAA_16
Motif
Other DBs
NCBI-GeneID: 887025
NCBI-ProteinID: NP_215789
TubercuList: Rv1273c
UniProt: P9WQJ1 I6Y645
Position
complement(1422302..1424050)
Genome map
AA seq 582 aa AA seqDB search
MLLALLRQHIRPYRRLVAMLMMLQLVSTLASLYLPTVNAAIVDDGVAKGDTATIVRLGAV
MLGVTGLQVLCAIGAVYLGSRTGAGFGRDLRSAMFEHIITFSERETARFGAPTLLTRSTN
DVRQILFLVQMTATVLVTAPIMCVGGIIMAIHQEAALTWLLLVSVPILAVANYWIISHML
PLFRRMQSLIDGINRVMRDQLSGVRVVRAFTREGYERDKFAQANTALSNAALSAGNWQAL
MLPVTTLTINASSVALIWFGGLRIDSGQMQVGSLIAFLSYFAQILMAVLMATMTLAVLPR
ASVCAERITEVLSTPAALGNPDNPKFPTDGVTGVVRLAGATFTYPGADCPVLQDISLTAR
PGTTTAIVGSTGSGKSTLVSLICRLYDVTAGAVLVDGIDVREYHTERLWSAIGLVPQRSY
LFSGTVADNLRYGGGPDQVVTEQEMWEALRVAAADGFVQTDGLQTRVAQGGVNFSGGQRQ
RLAIARAVIRRPAIYVFDDAFSALDVHTDAKVHASLRQVSGDATIIVVTQRISNAAQADQ
VIVVDNGKIVGTGTHETLLADCPTYAEFAASQSLSATVGGVG
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgctcctggccctgctgcgccagcacatccgaccgtaccgccggctggtcgcgatgctg
atgatgctgcagctggtcagcaccctggcttcgctatacctcccgacggtcaacgccgca
atcgtcgacgacggcgtcgccaagggcgacaccgccaccatcgtacggctgggtgcggtg
atgcttggggtgaccggattgcaggtgctgtgcgcgatcggggcggtctatctgggctcc
cggaccggggcgggtttcggccgtgacctgcgctcggcaatgttcgaacacatcatcacc
ttctcggaacgcgagaccgcccgattcggcgctccgacgttgttgacccgcagcaccaac
gacgtccggcagatcctgttcctggtccagatgaccgccaccgtgctggtcaccgcaccg
atcatgtgcgtcggcggaatcatcatggccatccaccaggaggccgcgctgacatggctg
ctgctggtcagcgttccgattctggccgtagcaaactactggatcatctcccacatgctg
ccgctcttccgccgcatgcagagcctgatcgacggcatcaaccgggtgatgcgcgatcag
ctgtccggggtgcgagtggtccgcgccttcacccgcgaaggctatgaacgcgacaagttc
gcgcaggccaatacggcgctgtcgaatgccgcactgagcgccggcaactggcaagcactg
atgctgccggtgaccacgctgaccatcaacgcatccagcgtcgcactgatctggttcggt
gggctacgcatcgacagcggccagatgcaggtcggctccctgatcgccttcctgtcctac
ttcgcccagatcctgatggcggtgttgatggcgaccatgacgctggccgtgctgccacga
gcgtcggtctgcgccgaacgcatcaccgaggtgctttccacgcccgccgcactcggtaac
cccgacaatcccaagttcccgacggacggggtcacgggcgtagtgcgcttggctggcgca
acctttacctatcctggcgccgactgcccggtgctgcaggacatttcgttgactgcgcgg
cccggtaccaccaccgcgatcgtcggcagtaccggttcgggcaagtcgacactggtgtcg
ttgatctgccggctctacgacgtcaccgctggcgcggtcttggttgacggtatcgacgtc
cgcgagtaccacaccgagcggctctggtcagcgatcgggctggtgccccagcgcagctac
ctcttctccggaaccgtcgcggacaacctgcgctacggcgggggcccagaccaggtagtc
accgagcaggagatgtgggaggcgctgcgggtcgccgcggccgacggctttgtacaaaca
gacgggctgcagacgcgtgtcgcccaaggtggtgtcaacttctccggcgggcagcgccaa
cggctggcgatagcccgagcggtcatccgacgtccggccatctatgtgttcgacgacgcg
ttctccgcacttgacgtgcacaccgacgccaaagtccacgcatcgctgcgacaggtatct
ggtgatgcaaccatcattgttgttacacaacggatttcgaatgccgctcaggccgaccag
gtcatcgttgtcgataacggtaagatcgtcggcacgggcacccacgaaacgctgctggcc
gattgccccacctatgccgaattcgccgcctcacaatcgctgagcgccacggtcgggggt
gtagggtga

DBGET integrated database retrieval system