KEGG   Mycobacterium tuberculosis H37Rv: Rv1285Help
Entry
Rv1285            CDS       T00015                                 

Gene name
cysD
Definition
(RefSeq) sulfate adenylyltransferase subunit 2
  KO
K00957  sulfate adenylyltransferase subunit 2 [EC:2.7.7.4]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00230  Purine metabolism
mtu00261  Monobactam biosynthesis
mtu00450  Selenocompound metabolism
mtu00920  Sulfur metabolism
mtu01100  Metabolic pathways
mtu01120  Microbial metabolism in diverse environments
mtu01130  Biosynthesis of antibiotics
Module
mtu_M00176  Assimilatory sulfate reduction, sulfate => H2S
mtu_M00616  Sulfate-sulfur assimilation
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    Rv1285 (cysD)
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Rv1285 (cysD)
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Rv1285 (cysD)
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    Rv1285 (cysD)
Enzymes [BR:mtu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.4  sulfate adenylyltransferase
     Rv1285 (cysD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PAPS_reduct ATP_bind_3 DpaA_N Diphthami_syn_2 QueC
Motif
Other DBs
NCBI-GeneID: 886979
NCBI-ProteinID: NP_215801
TubercuList: Rv1285
UniProt: P9WIK1
Position
1437909..1438907
Genome map
AA seq 332 aa AA seqDB search
MAITINMVNPTGFIRYEDVEQEAMTSDVTVGPAPGQYQLSHLRLLEAEAIHVIREVAAEF
ERPVLLFSGGKDSIVMLHLALKAFRPGRLPFPVMHVDTGHNFDEVIATRDELVAAAGVRL
VVASVQDDIDAGRVVETIPSRNPIQTVTLLRAIRENQFDAAFGGARRDEEKARAKERVFS
FRDEFGQWDPKAQRPELWNLYNGRHHKGEHIRVFPLSNWTEFDIWSYIGAEQVRLPSIYF
AHRRKVFQRDGMLLAVHRHMQPRADEPVFEATVRFRTVGDVTCTGCVESSASTVAEVIAE
TAVARLTERGATRADDRISEAGMEDRKRQGYF
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggcaataaccataaatatggtcaatcctaccggatttatcaggtatgaggacgtggaa
caggaagccatgaccagcgatgtgacggtgggccccgcacccggccagtaccaactgagc
catctgcgcttgctggaggccgaagccatccacgtcatccgggaggtggccgccgagttc
gagcggccagtgctgttgttctcggggggcaaggactccatcgtcatgctgcacctggcg
ctgaaggcgtttcggcccgggcgactgccgttcccggtcatgcacgtcgacaccggtcac
aacttcgacgaagttatcgctacccgagacgagttggtcgccgcggccggggtgcggctg
gtggtggcgtcggtgcaggacgatatcgatgccggtcgggtcgtcgagaccatcccgtcg
cgaaatccgatacagaccgtgacgctgctgcgggccatccgggagaaccaattcgacgcg
gcattcgggggagcccggcgcgacgaggagaaggcccgcgccaaggagcgggtgttcagc
ttccgcgacgagttcggccagtgggacccgaaggctcagcggccggaactgtggaacctc
tacaacggacggcaccacaagggcgagcacatccgggtcttcccgctgtccaactggacc
gaattcgacatctggtcctacatcggcgccgagcaggtcaggctgccgtccatctatttc
gcccaccggcgcaaggtgtttcagcgcgacggcatgttgctggccgtgcaccggcacatg
caaccgcgagccgacgagccggtgttcgaggccacggtgcgattccgcaccgtcggggat
gttacctgcaccgggtgcgtcgagtcgtcggcatcgacggtcgcggaagtcatcgccgaa
actgcggtggcccgcttgacggagcgcggggcgaccagggctgacgaccggatctcggag
gctggaatggaagaccgcaagcggcagggatacttctga

DBGET integrated database retrieval system