KEGG   Mycobacterium tuberculosis H37Rv: Rv1293Help
Entry
Rv1293            CDS       T00015                                 

Gene name
lysA
Definition
(RefSeq) diaminopimelate decarboxylase
  KO
K01586  diaminopimelate decarboxylase [EC:4.1.1.20]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00300  Lysine biosynthesis
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01120  Microbial metabolism in diverse environments
mtu01130  Biosynthesis of antibiotics
mtu01230  Biosynthesis of amino acids
Module
mtu_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    Rv1293 (lysA)
Enzymes [BR:mtu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.20  diaminopimelate decarboxylase
     Rv1293 (lysA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Orn_Arg_deC_N Orn_DAP_Arg_deC Ala_racemase_N
Motif
Other DBs
NCBI-GeneID: 886960
NCBI-ProteinID: NP_215809
TubercuList: Rv1293
UniProt: P9WIU7
Structure
PDB: 

Position
1448028..1449371
Genome map
AA seq 447 aa AA seqDB search
MNELLHLAPNVWPRNTTRDEVGVVCIAGIPLTQLAQEYGTPLFVIDEDDFRSRCRETAAA
FGSGANVHYAAKAFLCSEVARWISEEGLCLDVCTGGELAVALHASFPPERITLHGNNKSV
SELTAAVKAGVGHIVVDSMTEIERLDAIAGEAGIVQDVLVRLTVGVEAHTHEFISTAHED
QKFGLSVASGAAMAAVRRVFATDHLRLVGLHSHIGSQIFDVDGFELAAHRVIGLLRDVVG
EFGPEKTAQIATVDLGGGLGISYLPSDDPPPIAELAAKLGTIVSDESTAVGLPTPKLVVE
PGRAIAGPGTITLYEVGTVKDVDVSATAHRRYVSVDGGMSDNIRTALYGAQYDVRLVSRV
SDAPPVPARLVGKHCESGDIIVRDTWVPDDIRPGDLVAVAATGAYCYSLSSRYNMVGRPA
VVAVHAGNARLVLRRETVDDLLSLEVR
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgagctgctgcacttagcgccgaatgtgtggccgcgcaatactactcgcgatgaa
gtcggtgtggtctgcatcgcaggaattccactgacgcagctcgcccaggagtacgggacc
ccgctgttcgtcatcgacgaggacgactttcgctcgcgctgccgagaaaccgccgcggcc
tttggaagtggggcgaacgtgcactatgccgccaaggcgttcctgtgcagcgaagtagcc
cggtggatcagcgaagaagggctctgtctggacgtttgcaccggtggggagttggcggtc
gcgctgcacgctagctttccgcccgagcgaattaccttgcacggcaacaacaaatcggtc
tcagagttgaccgctgcggtcaaagccggagtcggccatattgtcgtcgattcgatgacc
gagatcgagcgcctcgacgccatcgcgggcgaggccggaatcgtccaggatgtcctggtg
cgtctcaccgtcggtgtcgaggcgcacacccacgagttcatctccaccgcgcacgaggac
cagaaattcgggttatcggtggccagcggcgcggccatggcagcggtgcggcgcgttttc
gccactgatcacctgcgcctggttgggctacacagccacatcggttcgcagatcttcgac
gtggacggcttcgaactcgccgcgcaccgtgtcatcggcctgctacgcgacgtcgtcggc
gagttcggtcccgaaaagacggcacagatcgcgaccgtcgatctcggtggcggcttgggc
atctcgtatttgccgtccgacgacccaccgccgatagccgagctcgcggccaagctgggt
accatcgtgagcgacgagtcaacggccgtggggctgccgacgcccaagctcgttgtggag
cccggacgcgccatcgccggaccgggcaccatcacgttgtatgaggtcggcaccgttaag
gacgtcgatgtcagcgccacagcgcatcgacgttacgtcagtgtcgacggcggcatgagc
gacaacatccgcaccgcgctctacggcgcgcagtatgacgtccggctggtgtctcgagtc
agcgacgccccgccggtaccggcccgtctggtcggaaagcactgcgaaagtggcgatatc
atcgtgcgggacacctgggtgcccgacgatattcggcccggcgatctggttgcggttgcc
gccaccggcgcttactgctattcgctgtcgagtcgttacaacatggtcggccgtcccgct
gtggtagcggtgcacgcgggcaacgctcgcctggtcctgcgtcgggagacggtcgacgat
ttgctgagtttggaagtgaggtga

DBGET integrated database retrieval system