KEGG   Mycobacterium tuberculosis H37Rv: Rv1294Help
Entry
Rv1294            CDS       T00015                                 

Gene name
thrA
Definition
(RefSeq) homoserine dehydrogenase
  KO
K00003  homoserine dehydrogenase [EC:1.1.1.3]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00260  Glycine, serine and threonine metabolism
mtu00270  Cysteine and methionine metabolism
mtu00300  Lysine biosynthesis
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01120  Microbial metabolism in diverse environments
mtu01130  Biosynthesis of antibiotics
mtu01230  Biosynthesis of amino acids
Module
mtu_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rv1294 (thrA)
   00270 Cysteine and methionine metabolism
    Rv1294 (thrA)
   00300 Lysine biosynthesis
    Rv1294 (thrA)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.3  homoserine dehydrogenase
     Rv1294 (thrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Homoserine_dh NAD_binding_3 ACT
Motif
Other DBs
NCBI-GeneID: 886962
NCBI-ProteinID: NP_215810
TubercuList: Rv1294
UniProt: P9WPX1 I6XB59
Position
1449375..1450700
Genome map
AA seq 441 aa AA seqDB search
MPGDEKPVGVAVLGLGNVGSEVVRIIENSAEDLAARVGAPLVLRGIGVRRVTTDRGVPIE
LLTDDIEELVAREDVDIVVEVMGPVEPSRKAILGALERGKSVVTANKALLATSTGELAQA
AESAHVDLYFEAAVAGAIPVIRPLTQSLAGDTVLRVAGIVNGTTNYILSAMDSTGADYAS
ALADASALGYAEADPTADVEGYDAAAKAAILASIAFHTRVTADDVYREGITKVTPADFGS
AHALGCTIKLLSICERITTDEGSQRVSARVYPALVPLSHPLAAVNGAFNAVVVEAEAAGR
LMFYGQGAGGAPTASAVTGDLVMAARNRVLGSRGPRESKYAQLPVAPMGFIETRYYVSMN
VADKPGVLSAVAAEFAKREVSIAEVRQEGVVDEGGRRVGARIVVVTHLATDAALSETVDA
LDDLDVVQGVSSVIRLEGTGL
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
gtgcccggtgacgaaaagccggtcggcgtagcggtactcggtttgggcaacgtcggcagc
gaggttgtccgcatcatcgagaacagcgccgaggatctcgcggctcgtgtcggtgcccca
ttggtcctgcggggcatcggcgtgcgccgcgtgacgaccgatcgcggcgtgccgatcgaa
ttgttgaccgacgacattgaagagctcgtggcccgcgaggatgtcgatatcgtggtggaa
gtgatggggccggtggaaccgtcgcgcaaggcgatcctgggcgcccttgagcgcggcaag
tccgtcgttacggcgaacaaggctttactcgccacctccaccggcgaattggcacaggcc
gccgaaagcgcccatgttgatctgtatttcgaggcggccgtggcgggcgccattccggtc
atccgtccgctcacccagtcgctggccggcgacacggtgctgcgagtggccgggatcgtc
aacggcaccaccaactacatcctctcggcgatggacagcaccggcgctgactatgccagc
gccctggccgacgcaagtgcgctgggctatgcggaggctgatcccaccgcagacgtcgaa
ggctacgacgccgcggccaaggcagcgatcctggcatccattgccttccacacccgggtg
accgcagacgacgtgtatcgcgaaggcatcaccaaggtcactccggccgacttcggatcc
gcgcacgcgctgggttgcaccatcaaactgctgtcgatctgtgagcgcataaccaccgac
gaaggttcgcagcgggtatcggcccgcgtctatccggccctggtacctctgtcgcatccg
cttgccgcggtcaacggcgcgttcaatgccgtggtggtcgaggccgaggccgcgggccgg
ctgatgttctacggccagggcgcgggcggcgcgccgaccgcctctgcggtgaccggtgac
ctagtgatggccgcccgcaaccgggtactcggcagccgcggcccccgtgagtctaaatac
gctcaacttccggtggcaccaatgggtttcattgaaacgcgctattacgtcagcatgaac
gtcgccgacaagccgggcgtcttgtccgcggtggcggcggaattcgccaaacgcgaggtg
agcatcgccgaggtgcgccaggagggcgttgtggacgaaggtggtcgacgggtgggagcc
cgaatcgtggtggtcacgcacctcgccactgacgccgcactctcggaaaccgttgatgca
ctggacgacttggatgtcgtgcagggtgtgtccagcgtgatacgactggaaggaaccggc
ttatga

DBGET integrated database retrieval system