KEGG   Mycobacterium tuberculosis H37Rv: Rv1295Help
Entry
Rv1295            CDS       T00015                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00260  Glycine, serine and threonine metabolism
mtu00750  Vitamin B6 metabolism
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01120  Microbial metabolism in diverse environments
mtu01230  Biosynthesis of amino acids
Module
mtu_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rv1295 (thrC)
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Rv1295 (thrC)
Enzymes [BR:mtu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Rv1295 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-GeneID: 886957
NCBI-ProteinID: NP_215811
TubercuList: Rv1295
UniProt: P9WG59 I6YA63
Structure
PDB: 

Position
1450697..1451779
Genome map
AA seq 360 aa AA seqDB search
MTVPPTATHQPWPGVIAAYRDRLPVGDDWTPVTLLEGGTPLIAATNLSKQTGCTIHLKVE
GLNPTGSFKDRGMTMAVTDALAHGQRAVLCASTGNTSASAAAYAARAGITCAVLIPQGKI
AMGKLAQAVMHGAKIIQIDGNFDDCLELARKMAADFPTISLVNSVNPVRIEGQKTAAFEI
VDVLGTAPDVHALPVGNAGNITAYWKGYTEYHQLGLIDKLPRMLGTQAAGAAPLVLGEPV
SHPETIATAIRIGSPASWTSAVEAQQQSKGRFLAASDEEILAAYHLVARVEGVFVEPASA
ASIAGLLKAIDDGWVARGSTVVCTVTGNGLKDPDTALKDMPSVSPVPVDPVAVVEKLGLA
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtcccgccgacggccactcaccagccgtggccgggagtgattgccgcgtaccgt
gaccggctgccggtgggtgacgactggactccggtgaccctgctcgagggtggtactccc
ctcatcgcggcaactaatctctccaagcagacgggctgcacgatccacctcaaagtggag
ggcctcaaccccaccggctccttcaaggatcgtggcatgacgatggcggtcaccgatgcc
cttgcccatggtcagcgggcggtcttgtgcgcatcgaccggaaatacctcggcgtcggcg
gcggcctatgccgcccgggccggcatcacctgcgcggtgctgataccgcagggcaagatc
gcgatgggcaagctcgcacaggcggtcatgcacggcgccaagatcatccagatcgacggt
aacttcgacgactgcctggaactggcgcgcaagatggccgcggacttcccgacgatttcg
ttggtcaactcggtaaacccggtgcgcatcgagggccagaaaacggcagcgttcgagatc
gtcgacgtgctaggtaccgcgccggacgtgcatgctctgccggttggcaacgccggcaac
atcaccgcgtactggaagggctacaccgagtatcaccagctgggcctgatcgacaagttg
ccccgcatgctgggcactcaggccgcgggcgcggcgcccctggtgctcggcgaaccggtg
agccacccggagaccatcgcaaccgcgatccgcatcggctcgccggcgtcgtggacttcg
gccgtcgaggcacagcagcagtccaagggccgcttcttggccgcctccgacgaggagata
ctggccgcatatcacctggtggctcgtgtcgaaggcgtattcgtggagcccgcgtccgca
gccagcattgcgggtctcctcaaagcgatcgacgacggctgggtggcgcgtggttcgacg
gtggtgtgcacggtaaccggcaacggtcttaaggatcccgacaccgcgctcaaagacatg
ccgagcgtgtctccggttcccgtggacccggtagccgtcgtcgagaagctagggctggcc
tag

DBGET integrated database retrieval system