KEGG   Mycobacterium tuberculosis H37Rv: Rv1296Help
Entry
Rv1296            CDS       T00015                                 

Gene name
thrB
Definition
(RefSeq) homoserine kinase
  KO
K00872  homoserine kinase [EC:2.7.1.39]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00260  Glycine, serine and threonine metabolism
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01120  Microbial metabolism in diverse environments
mtu01230  Biosynthesis of amino acids
Module
mtu_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rv1296 (thrB)
Enzymes [BR:mtu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.39  homoserine kinase
     Rv1296 (thrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-GeneID: 886958
NCBI-ProteinID: NP_215812
TubercuList: Rv1296
UniProt: P9WKE7 I6Y665
Position
1451997..1452947
Genome map
AA seq 316 aa AA seqDB search
MVTQALLPSGLVASAVVAASSANLGPGFDSVGLALSLYDEIIVETTDSGLTVTVDGEGGD
QVPLGPEHLVVRAVQHGLQAAGVSAAGLAVRCRNAIPHSRGLGSSAAAVVGGLAAVNGLV
VQTDSSPSSDAELIQLASEFEGHPDNAAAAVLGGAVVSWTDHSGDRPNYSAVSLRLHPDI
RLFTAIPEQRSSTAETRVLLPAQVSHDDARFNVSRAALLVVALTERPDLLMAATEDLLHQ
PQRAAAMTASAEYLRLLRRHNVAAALSGAGPSLIALSTDSELPTDAVEFGAAKGFAVTEL
TVGEAVRWSPTVRVPG
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggtgactcaagcattgttgccttctgggctggtggccagtgcggtggtggcggcgtcc
agtgcaaacctgggcccgggcttcgacagtgtcggtttggcgctgagtctctacgacgag
atcatcgtcgagacaacagattccggcttgacggtgactgtagacggcgagggcggcgac
caggtgccgctgggccccgagcacctcgtggtccgcgccgtgcagcacgggttacaggca
gcgggggtcagcgccgccggcctggcggtgcgctgccgcaacgccatcccgcactcccgc
ggcctcggctcctccgcggcagcagttgtgggcggtcttgcggccgttaacggtcttgtc
gtacaaacggattcgtcaccatcgagcgatgctgagctgattcagttggcttcggagttc
gagggtcatcccgacaacgcggcggccgcggttttgggtggtgccgtggtttcgtggact
gaccacagtggtgaccggcccaactattcggccgtatcactgcggcttcatcccgatatc
cgcctgttcactgcgattcccgagcagcgttcgtcgaccgcggaaacgcgggtgctattg
cccgcgcaggttagtcacgacgacgcacggttcaatgtcagtcgcgcggcgctgctggtg
gttgcgctcaccgaacggcccgatctgctgatggcggccaccgaagatctgcttcatcag
ccgcaacgtgccgcggcaatgacagcctccgcggaatatcttcggctgttgcggcgtcat
aacgtggcagcagcactgtccggggcaggtccttcgttgatcgccctgagtacagattca
gagttgccgaccgacgccgtggagttcggagccgcaaagggatttgccgttaccgagctg
actgttggcgaggcggttcgctggagcccgacagtaagagttcccggttaa

DBGET integrated database retrieval system