KEGG   Mycobacterium tuberculosis H37Rv: Rv1315Help
Entry
Rv1315            CDS       T00015                                 

Gene name
murA
Definition
(RefSeq) UDP-N-acetylglucosamine 1-carboxyvinyltransferase
  KO
K00790  UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00520  Amino sugar and nucleotide sugar metabolism
mtu00550  Peptidoglycan biosynthesis
mtu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Rv1315 (murA)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Rv1315 (murA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mtu01011]
    Rv1315 (murA)
Enzymes [BR:mtu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Rv1315 (murA)
Peptidoglycan biosynthesis and degradation proteins [BR:mtu01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   Rv1315 (murA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EPSP_synthase
Motif
Other DBs
NCBI-GeneID: 886921
NCBI-ProteinID: NP_215831
TubercuList: Rv1315
UniProt: P9WJM1 I6X0X6
Position
1470321..1471577
Genome map
AA seq 418 aa AA seqDB search
MAERFVVTGGNRLSGEVAVGGAKNSVLKLMAATLLAEGTSTITNCPDILDVPLMAEVLRG
LGATVELDGDVARITAPDEPKYDADFAAVRQFRASVCVLGPLVGRCKRARVALPGGDAIG
SRPLDMHQAGLRQLGAHCNIEHGCVVARAETLRGAEIQLEFPSVGATENILMAAVVAEGV
TTIHNAAREPDVVDLCTMLNQMGAQVEGAGSPTMTITGVPRLHPTEHRVIGDRIVAATWG
IAAAMTRGDISVAGVDPAHLQLVLHKLHDAGATVTQTDASFRVTQYERPKAVNVATLPFP
GFPTDLQPMAIALASIADGTSMITENVFEARFRFVEEMIRLGADARTDGHHAVVRGLPQL
SSAPVWCSDIRAGAGLVLAGLVADGDTEVHDVFHIDRGYPLFVENLVSLGAEIERVCC
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
gtggccgagcgtttcgtcgtgactgggggcaaccggttatcaggcgaagtggccgtcggc
ggcgccaagaacagcgtgctcaagctcatggctgcgacgttgttggccgagggcaccagc
acgatcaccaactgtcccgacatcctcgatgtgccgctgatggcggaggtactgcgtggt
ctgggcgccaccgtcgaactcgacggtgacgtggcccggatcaccgcacctgacgagccg
aagtacgatgccgacttcgctgcggtgcggcaattccgcgcctcggtctgtgtgctggga
ccgctggtcgggcggtgcaaacgggccagggtcgcgctgccgggcggtgacgcgatcggg
tcgcgtccgttggatatgcaccaggcgggcctacggcaattgggtgcccactgcaacatc
gagcacggctgcgtggtagcccgagcggaaacgttgcgcggtgcggagattcagttggag
ttcccctcggtgggagccaccgagaacatcttgatggccgccgtggtggccgagggagtc
accactattcacaatgcggctcgagaacccgacgtcgtcgacttgtgcacgatgttgaac
cagatgggcgcacaggtcgaaggtgcgggttcgccgacaatgaccatcaccggtgtcccg
cggctgcatccaaccgagcaccgggtgatcggagaccgtatcgttgccgccacatggggc
atcgctgccgcaatgacccgtggtgatatatcagtggcgggcgtagacccggcgcatctg
cagctggtgctgcacaaattgcacgacgcgggcgcaaccgtcacccagactgacgccagc
ttccgggtgacccagtacgagcgtccgaaggctgtcaacgttgcgaccttgccgttcccc
gggtttcccacggatctgcagccgatggctatcgctttggcgtcgatcgccgacggcaca
tcgatgatcacggagaacgtgttcgaggcgcggttccgcttcgttgaagagatgatccgg
ctcggtgcagacgctcggaccgacgggcaccacgccgtggtgcggggcctcccgcagctg
tcgagcgctccggtgtggtgttcggacatccgtgccggggccggcttggtgctggcgggg
ctcgttgccgacggcgacaccgaggtccacgatgtattccacatcgatcgcggatatccg
ttgttcgtggagaacctggtgagtctcggtgccgagatcgaacgggtatgctgttag

DBGET integrated database retrieval system