KEGG   Mycobacterium tuberculosis H37Rv: Rv1381Help
Entry
Rv1381            CDS       T00015                                 

Gene name
pyrC
Definition
(RefSeq) dihydroorotase
  KO
K01465  dihydroorotase [EC:3.5.2.3]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00240  Pyrimidine metabolism
mtu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    Rv1381 (pyrC)
Enzymes [BR:mtu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.2  In cyclic amides
    3.5.2.3  dihydroorotase
     Rv1381 (pyrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 DHOase Amidohydro_3
Motif
Other DBs
NCBI-GeneID: 886765
NCBI-ProteinID: NP_215897
TubercuList: Rv1381
UniProt: P9WHL3 I6YAE6
Position
1554188..1555480
Genome map
AA seq 430 aa AA seqDB search
MSVLIRGVRPYGEGERVDVLVDDGQIAQIGPDLAIPDTADVIDATGHVLLPGFVDLHTHL
REPGREYAEDIETGSAAAALGGYTAVFAMANTNPVADSPVVTDHVWHRGQQVGLVDVHPV
GAVTVGLAGAELTEMGMMNAGAAQVRMFSDDGVCVHDPLIMRRALEYATGLGVLIAQHAE
EPRLTVGAVAHEGPMAARLGLAGWPRAAEESIVARDALLARDAGARVHICHASAAGTVEI
LKWAKDQGISITAEVTPHHLLLDDARLASYDGVNRVNPPLREASDAVALRQALADGIIDC
VATDHAPHAEHEKCVEFAAARPGMLGLQTALSVVVQTMVAPGLLSWRDIARVMSENPACI
ARLPDQGRPLEVGEPANLTVVDPDATWTVTGADLASRSANTPFESMSLPATVTATLLRGK
VTARDGKIRA
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgtgctgattcgtggtgtgcggccctacggcgagggggagcgggtcgacgtactc
gtcgatgacggccagatcgcccagataggaccggatctggcgatccccgatacggccgat
gtcattgacgccaccggacacgtgctgctgcccgggttcgtcgatctgcacacccatctg
cgcgagccgggccgcgagtatgccgaggacatcgaaaccggttcggccgcggccgctttg
ggcggctacaccgcggtgttcgcgatggccaacaccaaccccgtggccgacagcccggtg
gtcaccgaccacgtctggcaccgcggccagcaggtcggcctggtcgacgtgcaccccgtc
ggcgcggtcaccgtcgggctggccggagccgagctgaccgagatgggcatgatgaacgcc
ggcgccgcccaggtgcggatgttctccgacgacggggtctgcgtgcatgacccgctgatc
atgcgccgcgccctggaatatgccaccggtttgggcgtgctgatcgcccagcacgccgag
gagccccggctgacggtcggcgccgtcgcgcacgagggacccatggcggcgcggctgggc
ctggcgggatggccgcgggccgccgaggaatcgatcgtcgcccgcgacgccttgctggcc
cgtgacgccggcgcccgggtgcacatctgtcacgcgtcggccgcgggcaccgtcgaaatc
ctgaaatgggctaaggaccagggtatttcgatcaccgccgaggtcaccccccaccacctg
ttgctcgacgatgccagattggccagctatgacggcgtgaaccgggtcaacccgccgctg
cgcgaagcttccgacgcggtcgccctgcgacaggcgctggccgacgggatcatcgactgt
gtggccacagatcacgccccgcatgccgagcacgagaaatgcgtcgaattcgccgcggcc
cggcccggcatgctcgggttgcagacggcattgtcggtggtggtgcagacaatggtggcg
cccggcttgttgagttggcgcgatatcgcgcgggtgatgagtgagaacccggcgtgcatc
gcacgcttgcccgatcagggccggccactggaggtgggggagccggccaacctgacggtg
gtggaccccgacgccacctggacggtcaccggcgccgacctggccagccggtcggccaac
acgccgtttgagtcgatgagcctgcccgccaccgtgaccgcgaccctgctgcgcgggaag
gtgaccgcgcgcgacgggaagatccgggcatga

DBGET integrated database retrieval system