KEGG   Mycobacterium tuberculosis H37Rv: Rv1385Help
Entry
Rv1385            CDS       T00015                                 

Gene name
pyrF
Definition
(RefSeq) orotidine 5'-phosphate decarboxylase
  KO
K01591  orotidine-5'-phosphate decarboxylase [EC:4.1.1.23]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00240  Pyrimidine metabolism
mtu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    Rv1385 (pyrF)
Enzymes [BR:mtu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.23  orotidine-5'-phosphate decarboxylase
     Rv1385 (pyrF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OMPdecase
Motif
Other DBs
NCBI-GeneID: 886763
NCBI-ProteinID: NP_215901
TubercuList: Rv1385
UniProt: P9WIU3 I6XBD1
Position
1560445..1561269
Genome map
AA seq 274 aa AA seqDB search
MTGFGLRLAEAKARRGPLCLGIDPHPELLRGWDLATTADGLAAFCDICVRAFADFAVVKP
QVAFFESYGAAGFAVLERTIAELRAADVLVLADAKRGDIGATMSAYATAWVGDSPLAADA
VTASPYLGFGSLRPLLEVAAAHGRGVFVLAATSNPEGAAVQNAAADGRSVAQLVVDQVGA
ANEAAGPGPGSIGVVVGATAPQAPDLSAFTGPVLVPGVGVQGGRPEALGGLGGAASSQLL
PAVAREVLRAGPGVPELRAAGERMRDAVAYLAAV
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgggttcggtctccggttggccgaggcaaaggcacgccgcggcccgttgtgtctg
ggcatcgatccgcatcccgagctgctgcggggctgggatctggcgaccacggccgacggg
ctggccgcgttctgcgacatctgcgtacgggccttcgctgatttcgcggtggtcaaaccg
caggtggcgttttttgagtcatacggggctgccggattcgcggtgctggagcgcaccatc
gcggaactgcgggccgcagacgtgctggtgttggccgacgccaagcgcggcgacattggg
gcgaccatgtcggcgtatgcgacggcctgggtgggcgactcgccgctggccgccgacgcc
gtgacggcctcgccctatttgggcttcggttcgctgcggccgctgctagaggtcgcggcc
gcccacggccgaggggtgttcgtgctggcggccacctccaatcccgagggtgcggcggtg
cagaatgccgccgccgacggccgcagcgtggcccagttggtcgtggaccaggtgggggcg
gccaacgaggcggcaggacccgggcccggatccatcggcgtggtcgtcggcgcaacggcg
ccacaggcccccgatctcagcgccttcaccgggccggtgctggtgcccggcgtgggggtg
cagggcgggcgcccggaggcgctgggcggtctgggcggggccgcatcgagccagctgttg
cccgcggtggcgcgcgaggtcttgcgggccggccccggcgtgcccgaattgcgcgccgcg
ggcgaacggatgcgcgatgccgtcgcctatctcgctgccgtgtag

DBGET integrated database retrieval system