KEGG   Mycobacterium tuberculosis H37Rv: Rv1392Help
Entry
Rv1392            CDS       T00015                                 

Gene name
metK
Definition
(RefSeq) S-adenosylmethionine synthetase
  KO
K00789  S-adenosylmethionine synthetase [EC:2.5.1.6]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00270  Cysteine and methionine metabolism
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Rv1392 (metK)
Enzymes [BR:mtu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.6  methionine adenosyltransferase
     Rv1392 (metK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: S-AdoMet_synt_C S-AdoMet_synt_M S-AdoMet_synt_N AdoMet_Synthase
Motif
Other DBs
NCBI-GeneID: 886741
NCBI-ProteinID: NP_215908
TubercuList: Rv1392
UniProt: P9WGV1 I6X149
Structure
PDB: 

Position
1566825..1568036
Genome map
AA seq 403 aa AA seqDB search
MSEKGRLFTSESVTEGHPDKICDAISDSVLDALLAADPRSRVAVETLVTTGQVHVVGEVT
TSAKEAFADITNTVRARILEIGYDSSDKGFDGATCGVNIGIGAQSPDIAQGVDTAHEARV
EGAADPLDSQGAGDQGLMFGYAINATPELMPLPIALAHRLSRRLTEVRKNGVLPYLRPDG
KTQVTIAYEDNVPVRLDTVVISTQHAADIDLEKTLDPDIREKVLNTVLDDLAHETLDAST
VRVLVNPTGKFVLGGPMGDAGLTGRKIIVDTYGGWARHGGGAFSGKDPSKVDRSAAYAMR
WVAKNVVAAGLAERVEVQVAYAIGKAAPVGLFVETFGTETEDPVKIEKAIGEVFDLRPGA
IIRDLNLLRPIYAPTAAYGHFGRTDVELPWEQLDKVDDLKRAI
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgaaaagggtcggctgtttaccagtgagtcggtgacagagggacatcccgacaag
atctgtgacgccatcagcgactcggttctggacgcgcttctagcggcggacccgcgctca
cgtgtcgcggtcgagacgctggtgaccaccgggcaggtgcacgtggtgggtgaggtgacc
acctcggctaaggaggcgtttgccgacatcaccaacacggtccgcgcacggatcctcgag
atcggctacgactcgtcggacaagggtttcgacggggcgacctgcggggtgaacatcggc
atcggcgcacagtcacccgacatcgcccagggggtcgacaccgcccacgaggcccgggtc
gagggcgcggccgatccgctggactcccagggcgccggtgaccagggcctgatgttcggc
tacgcgatcaatgccaccccggaactgatgccactgcccatcgcgctggcccaccgactg
tcgcggcggctgaccgaggtccgcaagaacggggtgctgccctacctgcgtccggatggc
aagacgcaggtcactatcgcctacgaggacaacgttccggtgcggctggataccgtggtc
atctccacccagcacgcggccgatatcgacctggagaagacgcttgatcccgacatccgg
gaaaaggtgctcaacaccgtgctcgacgacctggcccacgaaaccctggacgcgtcgacg
gtgcgggtgctggtgaacccgaccggcaagttcgtgctcggcgggccgatgggcgatgcc
gggctcaccggccgcaagatcatcgtcgacacctacggcggctgggcccgccacggcggc
ggcgccttctccggcaaggatccgtccaaggtggaccggtcggcggcgtacgcgatgcgc
tgggtggccaagaatgtcgtcgccgccgggttggctgaacgggtcgaggtgcaggtggcc
tacgccatcggtaaagcggcacccgtcggcctgttcgtcgagacgttcggtaccgagacg
gaagacccggtcaagatcgagaaggccatcggcgaggtattcgacctgcgccccggtgcc
atcatccgcgacctgaacctgttgcgcccgatctatgcgccgaccgccgcctacgggcac
ttcggccgcaccgacgtcgaattaccgtgggagcagctcgacaaggtcgacgacctcaag
cgcgccatctag

DBGET integrated database retrieval system