KEGG   Mycobacterium tuberculosis H37Rv: Rv1408Help
Entry
Rv1408            CDS       T00015                                 

Gene name
rpe
Definition
(RefSeq) ribulose-phosphate 3-epimerase
  KO
K01783  ribulose-phosphate 3-epimerase [EC:5.1.3.1]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00030  Pentose phosphate pathway
mtu00040  Pentose and glucuronate interconversions
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01120  Microbial metabolism in diverse environments
mtu01130  Biosynthesis of antibiotics
mtu01200  Carbon metabolism
mtu01230  Biosynthesis of amino acids
Module
mtu_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
mtu_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Rv1408 (rpe)
   00040 Pentose and glucuronate interconversions
    Rv1408 (rpe)
Enzymes [BR:mtu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.1  ribulose-phosphate 3-epimerase
     Rv1408 (rpe)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribul_P_3_epim QRPTase_C His_biosynth OMPdecase ThiG IGPS
Motif
Other DBs
NCBI-GeneID: 886702
NCBI-ProteinID: NP_215924
TubercuList: Rv1408
UniProt: P9WI51
Position
1584499..1585197
Genome map
AA seq 232 aa AA seqDB search
MSLMAGSTGGPLIAPSILAADFARLADEAAAVNGADWLHVDVMDGHFVPNLTIGLPVVES
LLAVTDIPMDCHLMIDNPDRWAPPYAEAGAYNVTFHAEATDNPVGVARDIRAAGAKAGIS
VKPGTPLEPYLDILPHFDTLLVMSVEPGFGGQRFIPEVLSKVRAVRKMVDAGELTILVEI
DGGINDDTIEQAAEAGVDCFVAGSAVYGADDPAAAVAALRRQAGAASLHLSL
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgctcatggccggtagcacggggggaccgctgatagcgccgtcgatcctagccgct
gatttcgccagactcgcggacgaagcggccgcggtcaacggcgccgactggttgcatgta
gacgtgatggacggtcacttcgtgccaaacctgaccatcggcctgccggtggtggagagc
ctgctggcggtcaccgacatcccgatggattgccatctaatgatcgacaacccggaccgg
tgggctccgccgtatgccgaggcgggcgcctacaacgtcaccttccacgcggaggccacc
gacaacccggtcggcgtggcccgcgatatccgggccgcgggggccaaagccgggatcagc
gtgaagccggggaccccgctggagccatacctggacatcctgccccatttcgacaccctg
ctcgtcatgtcggtagagcctggcttcggtggccagcggttcattcccgaggtgctgagc
aaggtgcgtgcggtgcgcaagatggtcgacgcgggcgagctgacgatcctggtcgagatc
gacggcggcatcaacgacgacacgattgagcaggctgccgaggccggcgtcgactgcttt
gtcgccggatcggcggtgtacggcgccgatgacccggccgcggcggttgcggcactacgg
cgacaggccggtgccgcctcactccacctgagcctatga

DBGET integrated database retrieval system